KEGG   Rubrobacter xylanophilus: Rxyl_2534Help
Entry
Rxyl_2534         CDS       T00368                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rxyl_2534
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rxyl_2534
  Amino acid metabolism
   00310 Lysine degradation
    Rxyl_2534
Enzymes [BR:rxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rxyl_2534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2551815..2553068)
Genome map
AA seq 417 aa AA seqDB search
MPVEIRVPELGESVTDATVGRWLKKEGEAVKSGEPIVEVETDKINFEIEAEQDGVLESIA
KGEGETVGVGDVIGTIAEGDGRAAAAAEEEEEPEEREEAPAAEAPAGREEAAEEGFRASP
SVRRLAQEYGVDLAEVSGTGSGGRITREDVERLIRERSRPPAAPEEDGRREERPAPPPER
APGREALEERVRFSRRRQTIAQRLVESQRNAAMLTTFNEVDMSAVMDLRRRRKESFQERT
GARLGFMSFFTKASVAALKAFPQVNAELAGNELVLKKYYDIGVAVSTDEGLVVPVVRDAD
RKSFAEIEKEIADLAVRAREGRLTLEDLRGGTFTITNGGVFGSLLSTPILTLPQVAILGM
HKVQERPVVVDGEIQVRPMMYVALSYDHRVIDGAEAVSFLVRIKELVEDPETLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
ttgccggttgagatacgcgtcccggagctcggggagtcggtcaccgacgccaccgtgggc
aggtggctcaaaaaggagggcgaggccgtaaagagcggcgagcccatcgtcgaggtcgag
acggacaagatcaacttcgagatagaggccgagcaggacggggtcctggagtccatagcg
aagggcgagggcgagacggtcggcgtcggcgacgtgatcgggacgatcgccgagggcgac
ggccgggccgcggcggccgcggaggaagaggaggagcccgaggagagggaggaggctccc
gcggcggaggctcccgccgggcgcgaggaggcggccgaggagggcttcagggcctccccc
tcggtgcgccgcctcgctcaggagtacggggtcgacctcgccgaggtctccgggaccggc
tccggcggcaggatcacccgggaggacgtggagcgcctgatccgggagcgttcccgcccg
cccgccgcgccggaggaggacggcaggagggaggagcgccccgccccgccgccggagcgg
gcgcccgggcgcgaggcgctcgaggagcgggtgcgcttctcgcgccggaggcagaccatt
gcccagcggctcgtcgagtcgcagcggaacgcggcgatgctcaccaccttcaacgaggtg
gacatgagcgccgtcatggacctcaggcggcggcgcaaggagtccttccaggagcgcacc
ggggcccggctgggcttcatgagcttcttcaccaaggcctccgtggccgccctcaaggcc
ttcccgcaggtcaacgccgagcttgcgggaaacgagctggtgctcaagaagtactacgac
atcggggtcgccgtctccaccgacgaggggctggtggtccccgtggtgcgcgacgccgac
agaaagagcttcgccgagatagagaaggagatagccgacctcgccgtccgggcgcgcgag
gggcggctcacgctcgaggacctgcgcggcggtacgttcaccatcaccaacggcggggtg
ttcggcagcctgctctccacccccatcctcacgctgccgcaggtggcgattttggggatg
cacaaggtgcaggagcgcccggtggtggtggacggggagatccaggtgcgccccatgatg
tacgtggcgctctcctacgaccaccgggtcatcgacggggcggaggcggtcagcttcctc
gtgcggatcaaggagctcgtggaggacccggagaccctgctcctggagggctag

DBGET integrated database retrieval system