KEGG   Rubrobacter xylanophilus: Rxyl_2550Help
Entry
Rxyl_2550         CDS       T00368                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase/formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rxy03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2573739..2574599)
Genome map
AA seq 286 aa AA seqDB search
MPELPEVETIKNDLRGLVVGSRIERAEVREPALVEQPPQEEFVRRLGGARVTGARRRAKH
LVVELDTGEALVFQLKIGGQLLLVPPVEEPEDSVMLVLSLDGGRRLLLRDQTGFSRARLL
GEKELAERLSGLGPEPFSEEFTVRYLKERLGSRRAQIKPLLLDQSLISGIGNIYADEILY
DARLSPRRRASSLSEEEWERLYAAIRSNLAAGIEHRGTTVRLYRDVLGRAGEHQNHLRVF
ERHGGPCPRCGAEVVRERVGGRPTHYCPRCQDGGGSAGDGVQLELE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgcccgaggtggagaccataaagaacgacctgcgcgggctggtggtcggc
tcgcgcatcgagcgcgcggaggtgcgagagcccgccctcgtcgagcagccgccccaggag
gagttcgtccggcggctgggcggcgcgcgcgtgaccggcgcccgcaggcgggccaagcac
ctcgtcgtggagctcgacaccggggaggcgctcgtgttccagctcaagatcgggggccag
ctcctgctcgtccccccggtggaggagcccgaggacagcgtcatgctcgtgctctctctc
gacggcgggcggcggctccttctgcgcgaccagaccgggttcagcagggcccggctcctc
ggcgaaaaagagctcgcggagcggctctccgggctcgggcccgagcccttctcggaggag
ttcacggtgcgctacctcaaagagaggctcggctcccgccgggcgcagataaagccgctc
ctgctcgaccagagcctcatctccggcataggcaacatctacgccgacgagatcctctac
gacgcccggctgagcccccggcgcagggcgagctccctctccgaagaggagtgggagagg
ctttacgccgccatccgcagcaacctcgccgccggcatcgagcaccggggcaccaccgtc
aggctctacagggacgtgctcggtcgggccggggagcaccagaaccacctgcgggtcttc
gagcgccacggcgggccgtgcccccgttgcggggcagaggtggtgcgcgagagggtcggc
gggcgcccgacccactactgcccccggtgccaggacgggggtggttccgcgggggatggg
gtacagttagaattggagtga

DBGET integrated database retrieval system