KEGG   Rubrobacter xylanophilus: Rxyl_2588Help
Entry
Rxyl_2588         CDS       T00368                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00010  Glycolysis / Gluconeogenesis
rxy00030  Pentose phosphate pathway
rxy00051  Fructose and mannose metabolism
rxy00052  Galactose metabolism
rxy00680  Methane metabolism
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01120  Microbial metabolism in diverse environments
rxy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_2588
   00030 Pentose phosphate pathway
    Rxyl_2588
   00051 Fructose and mannose metabolism
    Rxyl_2588
   00052 Galactose metabolism
    Rxyl_2588
  Energy metabolism
   00680 Methane metabolism
    Rxyl_2588
Enzymes [BR:rxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rxyl_2588
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Rxyl_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABG05505
JGI: Rxyl2588
UniProt: Q1ASX3
Position
complement(2609645..2610781)
Genome map
AA seq 378 aa AA seqDB search
MMNASLLGFLEGCPPGAEIWGVLDGFRGLVEGDLARLPPGCVDRRLYLSPGAWLGAGRRP
LGEGDPERCVERLAARGVRGLAMVGGNGTMWACARIEEAARRAGYGLAVVGIPKTVDNDL
AGTDHAPGFPSAARYVAAVVRDIGADLEAMRGFESVRVLETMGRNAGWLALSAGYLRREP
SDPPHLIYVPERPFDPDAFLGDVEAAVRAHGFVVAVVSEGLVRRPREEGLRRPVIGGVAP
ELARRVEEALGLPSRGELLGMGQRSFSLAASPLDREEARALGNRAARMLLEGRSGLMPAL
RRLPGRRYRVAVEEVPFGRVAGAERPLPPRWVVPPQEVPQGFRGWLAPLVGEDLAPHPPP
LVRRLRGAAAGREGRSES
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaacgccagcctgctcggttttctggagggctgcccgcccggggcggaaatctgg
ggggttctggacggcttccggggcctcgtcgagggcgacctcgcccgcctgccgccgggg
tgcgtagaccggcggctgtacctctcgcccggcgcctggctcggcgcggggcgccgcccg
ctcggcgagggcgacccggagcgctgcgtggagcgcctggcggcccgcggggtccgcggg
ctcgccatggtcgggggcaacggcaccatgtgggcctgcgccaggatagaggaggccgcc
cggagggccgggtacggcctcgcggtggtcggcatccccaagaccgtggacaacgacctc
gccggcaccgaccacgcccccggtttcccgagcgccgcccgctacgtggccgcggtggtc
cgggacatcggggcggacctggaggcgatgcggggcttcgagtcggtgcgggtgctcgag
accatgggccggaacgcaggctggctggcgctgagcgccggctatctgcggcgcgagccg
agcgacccgccgcacctgatctacgtccccgagcggcccttcgacccggacgcctttctg
ggggacgtggaggcggccgtgcgcgcccacggcttcgtggtggcggtggtgagcgagggg
ctcgtccggcgcccccgcgaggagggcctgcggcggcccgtgatcggcggggtcgccccc
gagctggcccgccgggtcgaggaggccctggggctgccttcccgcggggagctgctgggg
atgggccagcgcagcttctccctggccgcctcccccctcgaccgggaggaggcccgcgcg
ctcgggaaccgggccgcccggatgctcctggagggccgctccggcctgatgcccgcgctc
cgccgcctgccgggccggcggtaccgggtcgccgtggaggaggtccccttcggccgggtg
gcgggcgccgagcgccccctcccgccccgctgggtggtccccccgcaggaggttccccag
ggcttccggggctggctcgccccgctcgtcggcgaagatctcgcgccgcaccccccgccg
ctcgtccggcgcctccggggggcggccgcaggcagggaagggaggtccgagagttga

DBGET integrated database retrieval system