KEGG   Rubrobacter xylanophilus: Rxyl_2588Help
Entry
Rxyl_2588         CDS       T00368                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rxyl_2588
   01230 Biosynthesis of amino acids
    Rxyl_2588
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_2588
   00030 Pentose phosphate pathway
    Rxyl_2588
   00051 Fructose and mannose metabolism
    Rxyl_2588
   00052 Galactose metabolism
    Rxyl_2588
  Energy metabolism
   00680 Methane metabolism
    Rxyl_2588
Enzymes [BR:rxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rxyl_2588
Protein phosphatases and associated proteins [BR:rxy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rxyl_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2609645..2610781)
Genome map
AA seq 378 aa AA seqDB search
MMNASLLGFLEGCPPGAEIWGVLDGFRGLVEGDLARLPPGCVDRRLYLSPGAWLGAGRRP
LGEGDPERCVERLAARGVRGLAMVGGNGTMWACARIEEAARRAGYGLAVVGIPKTVDNDL
AGTDHAPGFPSAARYVAAVVRDIGADLEAMRGFESVRVLETMGRNAGWLALSAGYLRREP
SDPPHLIYVPERPFDPDAFLGDVEAAVRAHGFVVAVVSEGLVRRPREEGLRRPVIGGVAP
ELARRVEEALGLPSRGELLGMGQRSFSLAASPLDREEARALGNRAARMLLEGRSGLMPAL
RRLPGRRYRVAVEEVPFGRVAGAERPLPPRWVVPPQEVPQGFRGWLAPLVGEDLAPHPPP
LVRRLRGAAAGREGRSES
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaacgccagcctgctcggttttctggagggctgcccgcccggggcggaaatctgg
ggggttctggacggcttccggggcctcgtcgagggcgacctcgcccgcctgccgccgggg
tgcgtagaccggcggctgtacctctcgcccggcgcctggctcggcgcggggcgccgcccg
ctcggcgagggcgacccggagcgctgcgtggagcgcctggcggcccgcggggtccgcggg
ctcgccatggtcgggggcaacggcaccatgtgggcctgcgccaggatagaggaggccgcc
cggagggccgggtacggcctcgcggtggtcggcatccccaagaccgtggacaacgacctc
gccggcaccgaccacgcccccggtttcccgagcgccgcccgctacgtggccgcggtggtc
cgggacatcggggcggacctggaggcgatgcggggcttcgagtcggtgcgggtgctcgag
accatgggccggaacgcaggctggctggcgctgagcgccggctatctgcggcgcgagccg
agcgacccgccgcacctgatctacgtccccgagcggcccttcgacccggacgcctttctg
ggggacgtggaggcggccgtgcgcgcccacggcttcgtggtggcggtggtgagcgagggg
ctcgtccggcgcccccgcgaggagggcctgcggcggcccgtgatcggcggggtcgccccc
gagctggcccgccgggtcgaggaggccctggggctgccttcccgcggggagctgctgggg
atgggccagcgcagcttctccctggccgcctcccccctcgaccgggaggaggcccgcgcg
ctcgggaaccgggccgcccggatgctcctggagggccgctccggcctgatgcccgcgctc
cgccgcctgccgggccggcggtaccgggtcgccgtggaggaggtccccttcggccgggtg
gcgggcgccgagcgccccctcccgccccgctgggtggtccccccgcaggaggttccccag
ggcttccggggctggctcgccccgctcgtcggcgaagatctcgcgccgcaccccccgccg
ctcgtccggcgcctccggggggcggccgcaggcagggaagggaggtccgagagttga

DBGET integrated database retrieval system