KEGG   Rubrobacter xylanophilus: Rxyl_2828Help
Entry
Rxyl_2828         CDS       T00368                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rxy00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2833193..2833801)
Genome map
AA seq 202 aa AA seqDB search
MPTVMRAPETLFEVYGPRAGSLTVITGSMFSGKTEELIRRVRRALYARRSVQVFKHALDT
RAEGTAIRSHNGLLHEAAAVASSEELQARVEPATDLVAIEEVQFFDGRIVEVCRNLADGG
YDVIAAGLDMDFRGRPFGPVPALLAEADEVVKLRAICARCGREASRSQRLIDGRPAPATA
PTIMVGAEESYEARCRHCHEVP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgtgatgcgcgctccagagaccctgttcgaggtgtacggcccgcgcgcgggc
tcgctcaccgtcataaccggatcgatgttctcgggcaagacggaggagctgatccggcgc
gtccgccgcgccctctacgcccggcgcagcgtgcaggtcttcaagcacgccctcgacacc
cgcgcggaggggacggccatccgctcccacaacggcctgctgcacgaggccgccgcggtc
gcctccagcgaggagctgcaggcgcgggtggagcccgccacggacctggtcgccatcgag
gaggtgcagttcttcgacggcaggatcgtcgaggtctgccggaacctcgccgacgggggg
tacgacgtgatcgccgccgggctggacatggacttccgcggcaggcccttcgggccggtt
cccgccctgctcgccgaggcggacgaggtggtgaagctgcgcgccatctgcgcccgctgc
ggccgggaggcctcccgctcccagcgcctgatagacggccggccggcccccgccaccgcc
ccgacgatcatggtgggggccgaggagagctacgaggcccgctgccgccactgccacgag
gtgccctag

DBGET integrated database retrieval system