KEGG   Rubrobacter xylanophilus: Rxyl_2843Help
Entry
Rxyl_2843         CDS       T00368                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rxyl_2843
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Rxyl_2843
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Rxyl_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2850063..2850947
Genome map
AA seq 294 aa AA seqDB search
MTDTASKTSGRRIVLGHTNYGKSDIRLVKVFRNPGRHEIKELRVDVSQEGDFAAAHVEGD
NTGLMATDTMRNTVYALARDRLTGSAEAFGVELVRHFLEAAPRANRVRVSMVEHLWERIE
AGGKPHEHSFVRAAGERTAEVVGDEEGNFSVEAGIDDLLVLKTTNSGWAGFLRDRFTTLP
ETDDRILSTVVTSRWSYGGATDLDFDRLWEGIRRRILETFTDHYSPSVQFTLHRMGRAVL
ESFPEVERIHFSLPNRHHLLYDLERFGMENPGEVFHADAEPYGLIEGTVERSAS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccgccagcaagacctccggcaggaggatcgtgctcggccacaccaactac
ggcaagtcagacatccggctggtcaaggtgttccgcaacccggggcggcacgagatcaag
gagctgcgcgtggacgtctcccaggagggagacttcgccgccgcccacgtggagggggac
aacaccggcctcatggccaccgacacgatgcgcaacacggtctacgcgctggccagggac
cgcctgaccgggagcgccgaggccttcggggtggagctggtgcgccacttcctcgaggcc
gcgccccgggcgaaccgcgtccgcgtgagcatggtcgagcacctctgggagcgcatcgag
gccggcgggaagccgcacgagcactccttcgtccgggccgccggggagcgcacggccgag
gtggtcggcgacgaggagggcaacttcagcgtcgaggccggcatagacgacctcctggtc
ctcaagaccaccaactccggctgggcgggctttctgcgcgaccggttcaccaccctgccg
gagacggacgacaggatcctctccaccgtcgtgacctcccgctggtcctacggcggcgcc
accgacctggacttcgaccggctgtgggaggggatccgccggcgcatcctggagaccttc
accgaccactacagcccctccgtccagttcaccctccaccgcatgggacgggcggtgctg
gagagcttcccggaggtggagcgcatccacttctcgctgcccaaccgccaccacctcctc
tacgacctggagcgcttcgggatggagaaccccggcgaggtcttccacgccgacgccgag
ccctacggcctgatcgaagggaccgtggagaggtccgcctcttga

DBGET integrated database retrieval system