KEGG   Rubrobacter xylanophilus: Rxyl_2939Help
Entry
Rxyl_2939         CDS       T00368                                 

Definition
pyridine transhydrogenase subunit alpha
Orthology
K00324  
NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rxyl_2939
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     Rxyl_2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2947594..2947899
Genome map
AA seq 101 aa AA seqDB search
MEQFLAQLAVFVVAAFLGWELISRVPNLLHTPLMSATNAIHGVILVGGMIALSESTNPAI
TAVCFVAVFFGALNVVGGFWVTNRMLGMFAPPRRRVRRRKG
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtggagcagtttctggcgcagctcgccgtgttcgtggtcgcggcgtttctggggtgggag
ctcatctcgcgggtgcccaacctgctgcacacgccgctcatgagcgccaccaacgccatc
cacggcgtcatcctggtgggcggcatgatcgcgctctccgagagcaccaacccggcgatc
accgcggtgtgcttcgtggcggtctttttcggggcgctgaacgtcgtgggcggcttctgg
gtgaccaacaggatgctggggatgttcgccccgccgcgcaggcgggtcaggagaagaaag
ggttag

DBGET integrated database retrieval system