KEGG   Rubrobacter xylanophilus: Rxyl_3123Help
Entry
Rxyl_3123         CDS       T00368                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rxyl_3123
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_3123
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rxyl_3123
Enzymes [BR:rxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rxyl_3123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3133656..3134723
Genome map
AA seq 355 aa AA seqDB search
MSVQTLHRGQGVIRRWRGWLPEIPEQAVAELGEGDTPLVEATRLSGRVGARVYLKLEGLN
PTASFKDRGMTVAMSRAAAAGRTACVCASTGNTAASAAAYAARAGMVCFVVVPAGKIALG
KAVQVLAHGAEIVQIEGNFDAALRLSRRAAEELEHVALVNSVNPDRIEGQKTAAFEVCEA
LGRPPEALALPVGNAGNITAYWKGFTEWQRAGRAAGRPRMLGFQAAGAAPLVAGHDIESP
ETVASAIRIGSPASREGALRAVRESGGLIESVTDAEILEAQDLLAREEGVFCEPASAAGV
AGLLKLAREGRAPAGTAVCVLTGHGLKDPDAVLSRVRLPEPVPATFEDVARRLGA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgtccagacgttacacagagggcagggggtgatccggcggtggcgcgggtggctt
ccggagataccggagcaggccgtcgcagagctcggggagggcgacaccccgctggtcgag
gcgacgcggctctccgggagggtgggggcccgggtgtacctgaagctcgagggcctcaac
cccaccgcctcgttcaaggaccgggggatgacggtggccatgagccgggccgctgcggcc
gggcgcacggcctgcgtgtgcgcctccaccggcaacacggcggcctccgcggcggcgtac
gccgcccgggccgggatggtctgcttcgtggtggtcccggcgggcaagatcgcgctgggc
aaggcggtgcaggtgctggcgcacggggcggagatcgtccagatagagggcaacttcgac
gccgccctccggctctcgcgccgggcggcggaggagctggagcacgtggcgctggtgaac
tcggtgaacccggaccggatcgagggccagaagacggcggccttcgaggtctgcgaggcg
ctggggcggccgccggaggcgctggcgctcccggtgggcaacgcggggaacatcaccgcc
tactggaaggggttcaccgagtggcagcgggccgggcgcgccgccgggcggcccaggatg
ctcggcttccaggccgcgggggcggcgccgctggtcgccgggcacgacatcgagagcccg
gagacggtggcgagcgccatccgcatcggctccccggcgagccgggagggcgccctgcgg
gcggtgcgcgagtccggcggcctcatagagagcgtcaccgacgcggagatcctggaggcc
caggatctcctggcccgggaggagggcgtcttctgcgagcccgcctcggcggcgggggtg
gcggggctcctgaagctggcgcgggagggccgcgccccggcggggacggccgtctgcgtg
ctcaccggccacggcctcaaggacccggacgccgtgctcagccgcgtccggctgccggag
cccgtccccgccaccttcgaggacgtcgcccggaggctgggcgcgtga

DBGET integrated database retrieval system