KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0055Help
Entry
SAUSA300_0055     CDS       T00323                                 

Definition
alcohol dehydrogenase, zinc-containing
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:saa01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:saa00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:saa00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:saa00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:saa00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:saa00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64125..65222
Genome map
AA seq 365 aa AA seqDB search
MGAKKPYKESKPLKIEYLELDNPSEHEVLIKIHAAGLCHSDLSVINGNRPRPLPMALGHE
ASGEVIKVGKAVTRVSEGDHVVCTFIPSCGKCIPCKEGRPALCENGAISNEKGEMLEGGM
RLSNDEGKVYHHLGISGFAEYSVVSENSIVKIDKKIPFERAAAFGCAIITGIGAVVNTAQ
IRSGSNVAVVGLGGIGLNAIIGAKLAGANEIIALDINEDKFELAKQFGATATFNSSDKDI
DEQIKEYIPGGVEYAFETAGVVPAMKVAYQITKRGGTTVTTGLPNPKDNFSFPQVTLAAE
ERTIKGSYVGSCVPDRDIPRFVNLYNQGRLNIDSLISEVITLDEINEGFDRLSNGEVGRI
IMKMH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggggctaaaaagccctataaagaatctaaacctttaaaaattgaatacttagaactt
gataatcctagcgaacacgaagtattaattaaaattcatgcagctggattatgtcactct
gatttgtcagtaattaatggtaacagacctagacctttacctatggcacttggtcatgaa
gcttccggtgaagtaattaaagttggaaaagctgttacaagagttagcgaaggagatcat
gtggtatgcacatttattcccagttgtggaaaatgtatcccatgtaaagaaggacgtcct
gcattatgtgaaaacggagcaatatctaatgaaaaaggcgaaatgttagagggagggatg
cgtttatctaatgatgaaggaaaagtatatcatcacttggggatatcaggttttgctgaa
tattctgttgtctctgaaaactctatagttaaaattgataaaaaaataccttttgaacgt
gcagctgcatttggttgtgctattatcacaggtatcggtgctgtggtgaatacagcccaa
attcgttctggtagtaatgtagcggttgttggtttaggaggtattggattgaatgctatt
attggagctaaactagcgggagccaatgaaattattgctttagatattaacgaagataaa
tttgaattagcaaagcaatttggggctacagcaacatttaattcaagcgataaagatatc
gatgagcaaattaaagaatatattcctggcggagtagaatatgcttttgaaacagcgggt
gtagtgccagctatgaaagttgcttatcagattactaaacgaggggggacaactgtaaca
acaggactgcctaatcctaaagataatttttctttccctcaagttactttagcggctgaa
gaacgtaccattaaaggatcatatgtaggaagttgtgtacctgacagagatataccaagg
ttcgttaatctatacaaccaaggacgtttaaatattgattcactcatcagtgaggttatc
actttagatgaaattaatgagggatttgatcgtttgtctaatggtgaagtaggtagaatt
ataatgaagatgcattga

DBGET integrated database retrieval system