KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0262Help
Entry
SAUSA300_0262     CDS       T00323                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:saa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAUSA300_0262 (rbsK)
Enzymes [BR:saa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SAUSA300_0262 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(314498..315412)
Genome map
AA seq 304 aa AA seqDB search
MTNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGANQAIATARMQADTTFI
TKIGTDGVADFILEDFKVAHIDTSYIIKTAEAKTGQAFITVNAEGQNTIYVYGGANMTMT
PEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTVLNPAPAKALPNELLSLI
DIIVPNETEAELLSGIKVTNEQSMKDNANYFLSIGIKTVLITLGKQGTYFATKNQSQHIE
AYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKASSLTVQKHGAQASIPLLEE
VNQV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaaagttgttattttaggttcaacgaatgtcgatcaatttttaacagttgaa
agatatgcacaaccaggcgaaacattacatgttgaagaagcacaaaaagcattcggcgga
ggtaaaggtgccaaccaggctattgccactgcacgcatgcaagcagacacaacatttatt
actaaaattggcactgatggcgttgctgatttcatcttagaagattttaaagtagctcat
attgatacatcatatattatcaaaacagctgaagcaaaaacgggccaagcctttatcact
gtgaatgcagaaggacaaaacaccatctatgtttatggtggtgcgaatatgacgatgaca
cctgaagatgttattaacgcaaaagacgctataatcaatgcagactttgtcgttgcacaa
ttagaagtacccatcccggctattatatctgcatttgaaattgccaaggcacatggtgtg
acgacagtattaaatcctgcaccagcgaaagcattacctaatgaattattatcattaatc
gatattattgtgccaaacgaaacagaagccgaattgttatctgggattaaagtaactaat
gaacaatctatgaaagacaatgccaattactttttatctataggcattaagactgttttg
attacgctaggtaagcaaggtacatattttgctactaaaaatcaaagccaacacatcgaa
gcttataaagtaaatgcgattgatacaactgctgcaggcgacacatttattggtgcattt
gtcagtcgcttaaacaagtcgcaagataacttagcagatgctattgattttggtaataaa
gcgagctcactcactgtacaaaaacacggcgcgcaagcatctattcctctactagaagaa
gtaaatcaagtttaa

DBGET integrated database retrieval system