KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0355Help
Entry
SAUSA300_0355     CDS       T00323                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00071  Fatty acid degradation
saa00072  Synthesis and degradation of ketone bodies
saa00280  Valine, leucine and isoleucine degradation
saa00310  Lysine degradation
saa00362  Benzoate degradation
saa00380  Tryptophan metabolism
saa00620  Pyruvate metabolism
saa00630  Glyoxylate and dicarboxylate metabolism
saa00640  Propanoate metabolism
saa00650  Butanoate metabolism
saa00900  Terpenoid backbone biosynthesis
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
saa01120  Microbial metabolism in diverse environments
saa01130  Biosynthesis of antibiotics
saa01200  Carbon metabolism
saa01212  Fatty acid metabolism
saa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAUSA300_0355
   00630 Glyoxylate and dicarboxylate metabolism
    SAUSA300_0355
   00640 Propanoate metabolism
    SAUSA300_0355
   00650 Butanoate metabolism
    SAUSA300_0355
  Lipid metabolism
   00071 Fatty acid degradation
    SAUSA300_0355
   00072 Synthesis and degradation of ketone bodies
    SAUSA300_0355
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAUSA300_0355
   00310 Lysine degradation
    SAUSA300_0355
   00380 Tryptophan metabolism
    SAUSA300_0355
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAUSA300_0355
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAUSA300_0355
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAUSA300_0355
Enzymes [BR:saa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAUSA300_0355
Exosome [BR:saa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAUSA300_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ABD22902
UniProt: Q2FJQ9
Position
406009..407190
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system