KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0758Help
Entry
SAUSA300_0758     CDS       T00323                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00010  Glycolysis / Gluconeogenesis
saa00051  Fructose and mannose metabolism
saa00562  Inositol phosphate metabolism
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
saa01120  Microbial metabolism in diverse environments
saa01130  Biosynthesis of antibiotics
saa01200  Carbon metabolism
saa01230  Biosynthesis of amino acids
Module
saa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
saa_M00002  Glycolysis, core module involving three-carbon compounds
saa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAUSA300_0758 (tpiA)
   00051 Fructose and mannose metabolism
    SAUSA300_0758 (tpiA)
   00562 Inositol phosphate metabolism
    SAUSA300_0758 (tpiA)
Enzymes [BR:saa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAUSA300_0758 (tpiA)
Exosome [BR:saa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAUSA300_0758 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAUSA300_0758 (tpiA)
  Exosomal proteins of melanoma cells
   SAUSA300_0758 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABD22760
UniProt: Q2FIL9
Structure
PDB: 

Jmol
Position
845808..846569
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattaccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcacgctattttcaaa
catggaatgactccaattatatgtgttggtgaaacagacgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagatcaa
cttaaatcagttgtaattgcttatgaaccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcaaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system