KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0763Help
Entry
SAUSA300_0763     CDS       T00323                                 

Gene name
est
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Brite
Enzymes [BR:saa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SAUSA300_0763 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850737..851477
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPDEI
LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMDHFKPTETLKELSEALDTIKEQVDEVLD
PILVIQAENDNMIDPQSANYIYDHVDSDDKNIKWYSESGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaaattaccaaaacctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtctgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcatatgcaccgcaatatgaaggccacgcggcaccaccagatgaaata
ctgaaatctagtcctttcgtttggtttaaagatgcgttagatggttatgattatcttgtt
gaacaaggttatgatgaaattgttgttgctggtctatcattaggtggggattttgcttta
aaattaagcttaaatagagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagaatatgcacgcaattttaaaaagtat
gaaggtaaagatcaagagactattgataatgaaatggatcattttaaaccaactgaaact
ttaaaagaactaagtgaagcattagatacgattaaagagcaagttgatgaagtgttggat
cctattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaccatgtagattctgatgacaaaaatatcaagtggtacagtgaatctggacat
gttattacgattgataaagagaaagaacaagtatttgaagatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system