KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0864Help
Entry
SAUSA300_0864     CDS       T00323                                 

Gene name
argG
Definition
(GenBank) argininosuccinate synthase
  KO
K01940  
argininosuccinate synthase [EC:6.3.4.5]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAUSA300_0864 (argG)
   00220 Arginine biosynthesis
    SAUSA300_0864 (argG)
Enzymes [BR:saa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     SAUSA300_0864 (argG)
Exosome [BR:saa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAUSA300_0864 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(943441..944646)
Genome map
AA seq 401 aa AA seqDB search
MKEKIVLAYSGGLDTSVAVQWLIDKGYDVVACCLDVGEGKDLDIVYKKALDMGAVECHII
DATKEFSDEYVSYAIKGNLMYENAYPLVSALSRPLIAKKLVEIAEKTNSVGIAHGCTGKG
NDQVRFEVAIKALNPSLKAFAPVREWAWSREEEIDYAIKHNIPVSINHDSPYSIDQNLWG
RANECGILEDPYAAPPEDAFDLTNALEETPDTADEIILTFDKGIPVQIDGKTYELDDLIL
TLNALAGKHGIGRIDHVENRLVGIKSREIYEAPAAEVILKAHKALETITLTKDVAHFKPI
IEKQFAEQLYNGLWFSPLTDSLKLFIDSTQQYVSGDVRIKLFKGNAIVNGRKSPYTLYDE
KLATYTKEDAFNQDAAVGFIDIYGLPTQVNAMLHGGYSNEQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaaattgttttagcatattcaggaggactagatacaagtgtggccgttcaa
tggcttatcgacaaaggatacgacgttgtagcttgttgcctagatgttggtgaaggtaaa
gatttagacatcgtttataaaaaagctttagatatgggagcagttgaatgtcatattatt
gatgcaacaaaagaatttagtgatgagtatgtaagttatgcaatcaaaggaaatttaatg
tatgaaaatgcatatccattagtttcagctttatcaagaccattaatcgctaaaaaatta
gtagagattgctgagaaaacaaattcagtaggtattgcacatggttgtactggtaaaggg
aatgaccaagtacgtttcgaagttgccattaaagcattaaacccatcattgaaagcattc
gcacctgtacgtgagtgggcatggagtcgtgaagaagaaatcgattatgcaattaaacat
aatatccctgtatcaatcaaccatgattcaccttattctatcgatcaaaatctatggggc
agagcgaatgaatgtggtattttagaagatccttatgctgcgccaccagaggatgcgttc
gatctaacaaatgctttagaagaaacaccagatactgctgatgaaatcattttaacgttt
gataaaggcatcccagttcaaattgatggcaaaacatatgaattagacgatttaatttta
acgttgaatgcattagctggtaagcatggtatcggaagaattgaccatgtagaaaataga
cttgtaggtatcaaatcaagagaaatttatgaggcacctgctgcagaagttattttaaaa
gcgcataaagcattagaaacgattacgttaacgaaagatgtcgcacactttaaaccaatc
attgagaagcaatttgctgaacaactatacaatggactttggttctcacctttaactgat
agcttgaaattatttattgatagtactcagcaatacgtaagtggtgatgtcagaattaaa
ttattcaaaggtaatgccatcgtgaatggtagaaaatcaccttacacattatatgatgaa
aaattagcaacttatacaaaagaagatgcatttaatcaagacgctgctgttggctttatc
gatatctatggtttacctactcaagtaaatgcgatgttgcatggaggctatagcaatgag
caataa

DBGET integrated database retrieval system