KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0995Help
Entry
SAUSA300_0995     CDS       T00323                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00010  Glycolysis / Gluconeogenesis
saa00020  Citrate cycle (TCA cycle)
saa00620  Pyruvate metabolism
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
saa01120  Microbial metabolism in diverse environments
saa01130  Biosynthesis of antibiotics
saa01200  Carbon metabolism
Module
saa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAUSA300_0995
   00020 Citrate cycle (TCA cycle)
    SAUSA300_0995
   00620 Pyruvate metabolism
    SAUSA300_0995
Enzymes [BR:saa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAUSA300_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 ATP-synt_ab_Xtn HlyD_D23 DUF896 DUF2090 HTH_17
Motif
Other DBs
NCBI-ProteinID: ABD22305
UniProt: A0A0H2XJG3
Position
1090716..1092008
Genome map
AA seq 430 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
EVAETPAAPAAVTLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
NNPELLLMEG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgta
aaatggtttgttaaagctggagatactattgaagaagacgatgttttagctgaggtacaa
aacgataaatcagtagtagaaatcccatcaccagtatctggtactgtagaagaagttatg
gtagaagaaggtacagtagctgtagttggtgacgttattgttaaaatcgatgcacctgat
gcagaagatatgcaatttaaaggtcatgatgatgattcatcatctaaagaagaacctgcg
aaagaggaagcgccagcagagcaagcacctgtagctactcaaactgaagaagtagatgaa
aacagaactgttaaagcaatgccttcagtacgtaaatacgcacgtgaaaaaggtgttaac
attaaagcagtttctggatctggtaaaaatggtcgtattacaaaagaagatgtagatgca
tacttaaatggtggtgcaccaacagcttcaaatgaatcagctgcttcagctacaagtgaa
gaagttgctgaaactcctgcagcacctgcagcagtaacattagaaggcgacttcccagaa
acaactgaaaaaatccctgctatgcgtagagcaattgcgaaagcaatggttaactctaag
catactgcacctcatgtaacattaatggatgaaattgatgttcaagcattatgggatcac
cgtaagaaatttaaagaaatcgcagctgaacaaggtactaagttaacattcttaccttat
gttgttaaagcacttgtttctgcattgaaaaaatacccagcacttaacacttcattcaat
gaagaagctggtgaaatcgttcataaacattactggaatatcggtattgcagcagacact
gatagaggattattagtacctgttgttaaacatgctgatcgtaagtctattttccaaatt
tcagatgaaattaatgaattagctgttaaagcacgtgatggtaaattaacagccgatgaa
atgaaaggtgctacatgcacaatcagtaatatcggttcagctggtggacaatggttcact
ccagttatcaatcacccagaagtagcaatcttaggaattggccgtattgctcaaaaacct
atcgttaaagatggagaaattgttgcagcaccagtattagcattatcattaagctttgac
cacagacaaattgatggtgcaactggccaaaatgcaatgaatcacattaaacgtttatta
aataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system