KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1093Help
Entry
SAUSA300_1093     CDS       T00323                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:saa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:saa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1195628..1196509
Genome map
AA seq 293 aa AA seqDB search
MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttattatcaatggaacatttatctacagatcaaatatacaaacttatccaa
aaggcaagtcaatttaaatctggtgaacgtcaactaccaaactttgaagggaaatatgtc
gcaaatttattctttgaaaattctactcgaacaaaatgtagttttgaaatggcagaactt
aagctagggttaaaaacgattagctttgaaacatcaacatcatctgtttcaaaaggtgaa
tctttatatgacacatgtaaaactttagaaagtattggctgtgatttattagtcattaga
catccgtttaataactactatgaaaaattagcgaatattaacatcccaattgcgaatgct
ggtgatggtagtggacaacatccaacacaaagtttacttgatttaatgacgatatatgaa
gaatatggatattttgaaggcttgaatgtattgatttgtggagacattaaaaattcacgt
gtcgcacgtagtaattaccatagtttaaaagcattaggtgcaaacgtaatgtttaatagc
ccaaatgcttggattgatgattctttagaagcaccttatgtaaatatagatgatgttata
gaaacagtagatatagttatgttattaagaattcaacatgaaaggcatgggcttgcagaa
gaaactagatttgcagcagatgattatcatcaaaagcatggcttaaatgaagtacgctat
aacaaattacaagaacatgctattgttatgcatccggcacctgtgaatagaggagtagaa
atacaaagcgatttagtagaagcttcaaaatcaagaatttttaagcaaatggaaaatggc
gtttacttaagaatggcagtcattgatgaattattaaaatag

DBGET integrated database retrieval system