KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1645Help
Entry
SAUSA300_1645     CDS       T00323                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:saa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAUSA300_1645 (pfkA)
   01230 Biosynthesis of amino acids
    SAUSA300_1645 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAUSA300_1645 (pfkA)
   00030 Pentose phosphate pathway
    SAUSA300_1645 (pfkA)
   00051 Fructose and mannose metabolism
    SAUSA300_1645 (pfkA)
   00052 Galactose metabolism
    SAUSA300_1645 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SAUSA300_1645 (pfkA)
Enzymes [BR:saa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAUSA300_1645 (pfkA)
Protein phosphatases and associated proteins [BR:saa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SAUSA300_1645 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1806542..1807465)
Genome map
AA seq 307 aa AA seqDB search
MNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYSARCPE
FKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQTIGIPGTIDNDINGT
DFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPE
VKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYINVDNRVSVLGHVQRG
GSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDEIFDGKDHKFDYSLYE
LANKLSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgccgtaagagcagttgttcgtacagcaatttacaatgaaattgaagtttat
ggtgtgtatcatggttaccaaggattgttaaatgatgatattcataaacttgaattagga
tcagttggggatacgattcagcgtggaggtacattcttgtattcagcaagatgtccagag
tttaaggagcaagaagtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgag
ggccttgtagttattggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaa
tgtaaagaaattcaaactatcggtattcctggtacgattgacaatgatatcaatggtact
gattttacaattggatttgacacagcattaaatacgattattggcttagtcgacaaaatt
agagatactgcgtcaagtcacgcacgaacatttatcattgaagcaatgggccgtgattgt
ggagatctagcattatgggctggattatcagttggtgctgagacaattgtagttccagaa
gtgaaaacagatattaaagaaatagctgataaaattgaacaaggtattaaacgtggtaag
aaacactcaatcgttcttgtagcagaaggttgtatgactgcgcaagattgtcaaaaagaa
ttatcacaatacatcaatgttgataatagagtgtctgtgttaggtcacgttcaacgtggt
ggtagcccaacaggtgcggatagagttttagcatcacgtttaggtggatatgcggtagac
ttattaatgcaaggtgaaacagctaagggtgttggaattaagaacaataaaattgtagca
acatcttttgatgaaatttttgatggtaaagatcataaatttgattatagtctatatgaa
cttgctaacaagttatctatataa

DBGET integrated database retrieval system