KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2011Help
Entry
SAUSA300_2011     CDS       T00323                                 

Gene name
leuB
Definition
3-isopropylmalate dehydrogenase (EC:1.1.1.85)
Orthology
K00052  
3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:saa01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:saa01230]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:saa00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2171315..2172361
Genome map
AA seq 348 aa AA seqDB search
MTYNIVALPGDGIGPEILNGSLSLLEIISNKYNFNYQIEHHEFGGASIDTFGEPLTEKTL
NACKRADAILLGAIGGPKWTDPNNRPEQGLLKLRKSLNLFVNIRPTTVVKGASSLSPLKE
ERVEGTDLVIVRELTSGIYFGEPRHFNNHEALDSLTYTREEIERIVHVAFKLAASRRGKL
TSVDKENVLASSKLWRKVVNEVSQLYPEVTVNHLLVDACSMHLITNPKQFDVIVCENLFG
DILSDEASVIPGSLGLSPSASFSNDGPRLYEPIHGSAPDIAGKNVANPFGMILSLAMCLR
ESLNQPDAADELEQHIYSMIEHGQTTADLGGKLNTTDIFEILSQKLNH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacttataacattgttgccctacctggtgatggaatcggtccagaaattttgaacgga
tctctatcattgcttgaaattataagtaataaatataactttaattatcaaatagagcac
cacgaatttggtggtgcctctattgatacattcggcgagcctttaactgagaaaacctta
aatgcgtgtaaaagagcagatgctattttactgggtgcaatcggtggacctaaatggaca
gatcctaacaatcgaccagaacaaggattattaaaattgcgtaaatccttaaatttattt
gtaaatatacgccccactaccgttgtcaaaggcgctagttctttatcacctttaaaggaa
gaacgcgttgaaggcacagatttagttatagtccgtgaattgacaagtggtatttatttt
ggagaacctagacattttaataatcacgaggccttagattctcttacttatacaagagaa
gaaatagaacgcattgttcacgtagcatttaaattggccgcttcaagacgaggaaaacta
acatcagttgataaagaaaatgtattagcttctagtaaattgtggcgcaaagtcgtaaat
gaagtaagtcaattatatccagaagtaacagtaaatcacttacttgttgatgcttgtagt
atgcatttaatcacaaatccaaaacaatttgacgtcatcgtatgtgaaaacttatttggc
gatattttaagtgatgaagcttcagtgattcctggttcacttggtttatcaccttctgct
agttttagtaacgatggtccaagattgtatgagcctattcatggatcagcaccagatatt
gcaggtaaaaacgttgccaatccatttggaatgattctatctttagcgatgtgtttacgt
gaaagcttaaatcaaccagatgctgcagatgaattagaacaacatatttatagcatgatt
gaacatgggcaaacgacagcagatttaggcggcaaattgaatactactgatattttcgaa
attctatctcaaaaattgaatcactaa

DBGET integrated database retrieval system