KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2147Help
Entry
SAUSA300_2147     CDS       T00323                                 

Definition
alcohol dehydrogenase, zinc-containing
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:saa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAUSA300_2147
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAUSA300_2147
  Lipid metabolism
   00071 Fatty acid degradation
    SAUSA300_2147
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAUSA300_2147
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAUSA300_2147
   00626 Naphthalene degradation
    SAUSA300_2147
Enzymes [BR:saa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAUSA300_2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2323952..2324953)
Genome map
AA seq 333 aa AA seqDB search
MQNKQILFNKIPEGMPQEDTFKIEEIDTPKLESDGVLVQTLYISVDPYMRGRMTKADSYV
QPFEIGKPIVSHVVAKVIDSTLADYKKGDVVVGMLPWRIINHVQADQITKVPTTDVPLDL
YLSVLGMPGQTAYHGLLDIGQPKAGDTVVVSAASGAVGSVVGQIAKIKGCRVVGIAGGDK
KVNYLTETLGFDAGIDYKKEDFAEALAQAVPDGIDVYFENVGGTVGDEVFKHLNRFARVP
VCGAISSYNHPEADIGPRIQGTLIKKQVMMRGFLVSEFANAFKEASEQLATWVQEGKIQS
QVTIEDGFENAPHAFKNLFTGDNFGKQVIKVTE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaacaaattctttttaacaaaataccagaaggcatgcctcaagaggataca
ttcaaaattgaagagattgacacgcctaaacttgagagcgatggtgtacttgtacaaacg
ctgtatatttcagtggatccatatatgagaggacgtatgactaaggcagattcgtatgta
cagccttttgaaattggtaaaccgattgttagccatgtcgttgcaaaagtaattgattcg
acactcgcagattataaaaaaggagatgtcgttgtaggtatgttgccttggcgaatcatt
aatcatgtccaagcggatcaaattactaaagttccaacgacagatgtaccacttgattta
tatttaagtgttttaggaatgccaggacaaacagcatatcatggtctgcttgatattgga
caacctaaagccggtgatactgttgtggtttcagctgcatctggtgctgtaggttcagtt
gtaggtcaaattgctaagattaaaggttgccgtgtagtaggtattgcgggtggcgacaaa
aaagtaaattatttaacagagacactgggctttgacgctggtattgattataagaaagag
gattttgcagaagcgttagcacaagcagtaccagatggtattgatgtttattttgaaaat
gttggtggaacagttggcgatgaagtatttaagcatttaaatcgttttgcacgtgtacca
gtatgtggcgcaatttcgtcatataatcatcctgaagccgatatcggaccacgtattcaa
ggtacgcttattaagaagcaagtaatgatgagaggcttcttggtaagtgaattcgctaat
gcttttaaagaagctagtgaacagcttgcaacatgggttcaagaaggtaaaattcagtca
caagtaaccattgaagatggttttgaaaatgcgccacatgcatttaaaaatttatttact
ggcgataactttggtaaacaagttattaaagtaacggaataa

DBGET integrated database retrieval system