KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2285Help
Entry
SAUSA300_2285     CDS       T00323                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:saa00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:saa00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2457407..2458426)
Genome map
AA seq 339 aa AA seqDB search
MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
KFGASIGRYSGRIDNAKFKLKGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPTNHVYFNLNRDN
NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagttgagcaccaaagacaaggtgtagatttaatcaaaattgataatgat
gaaactaaaattatttttacgaattatggagcaagagtagtgtcttggaaatatcatgat
aataatattgttcttggaaatgttgttgaagcggatgaattttatcatagtaatcctttt
aaatttggtgcttctataggaagatatagcggtagaattgataatgctaaatttaagttg
aaaggtaaagaatatcagttagaaaaaaacaacggtgaacatcatttacatggtggatgt
catggtttggacaataagttatttgattatgaaattagaaatgaaattgctcaaattaaa
gttatatttaagacggtgttgaaatcagctgatgatcatttcccgggtgatatcgatgtg
acgattacacatatttatgatgcggatcaccaatggtcgattgaatacgaagcagttgca
tcagaagacacattgtttagtcctacgaatcatgtgtacttcaatttgaatcgagataat
aatgtcgttgataatcatcgcatttcaagtaatcaattagatatgtatgtattagatgag
cgaaatattgttacaggtgatattctagatttacatgaagtgtttgaagataacaagata
aaattgagtgatatttttacatcacaacatgcgcaattaagccaacaaatgacacgtttt
ggtggtctcgatcacccatttacagttggtgaacataaaatgtatgttgaaaatcatgaa
tttatgttagaggtcgatacagatatgcctcatgttgtgttctttacttttaaccagcct
gatgagtgggatagtccatttaatatttataaaccacattctggctttacattagaaaca
caatttttaccaaatgatattaatttatatggtgaaaaagcaccgtcaattttaaaagct
ggtgaagtgttcaattcgaaaacaagtttccgtatcgaagaaaaagtagaaaatgattaa

DBGET integrated database retrieval system