KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2455Help
Entry
SAUSA300_2455     CDS       T00323                                 

Definition
putative fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:saa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:saa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:saa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:saa00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:saa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2651284..2653248
Genome map
AA seq 654 aa AA seqDB search
MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKERLSTKELNDLTALVYYPEDKLKLIKSDFQNCGQLNVWYITT
IEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDTNEITVYGNT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPYNGN
LLIHGCIPVDENGEMESFEIDGHTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaaaagaattaaaaaagaagtatttagatttactatcccaaaat
tttgatactccagaaaaacttgcaactgaaattatcaatttagaatcaattttagaatta
cctaaaggtacggaacatttcgtcagcgatttacatggtgaatatgaagctttccaacac
gtattacgcaacggttctgggaacgtgcgagcgaaaatcaatgatattttcaaagagaga
ctttcaactaaggagcttaatgacttaactgctcttgtctactatccagaagacaaatta
aaattgattaaaagtgatttccaaaattgcggtcaacttaatgtctggtatatcacaaca
atcgaacatttaattgagttaattaaatattgttcttcaaaatatacgcgttcaaaactg
cgtaaagcattgccaaaacaatacgtttatattattgaggaactactgtataaaagtaat
gaatatcaaaataaaaaatcatattacgaaacacttgttaaccaagtaattgaacttaaa
caggcagatgatttaattattggactcgcttattccgtacaacgcttagtcgtcgatcat
ttacacgttgtcggtgatatttatgatcgtggaccacaaccagataaaattatggataca
ctgattaattatcattccctagatattcaatggggtaatcatgatgtgctttgggttgga
gcctatgctgggtcaaaagtatgcttagcaaacttacttcgaatttgtgcacgttatgat
aatttagatattatcgaagacgcttatggcattaatttaagaccactgcttactttagct
gaaaaatactatgacgcagataatcctgcttttaagcctaaaaaaagacctgacaaacac
gaacgtttaactcaacgtgaagaaagtcaaattactaaaattcatcaagctattgcgatg
attcaattcaagttagaaataccaattattaaacgtcgtccaaatttcgaaatggaagaa
cgtcttgtgcttgaaaaggttaattatgatacaaatgaaattacagtttatggtaataca
tacccattgaaagacacatgtttccaaactgtcaatcgtgataatccagcagaattacta
cctgaagaagaagaagtcatgaataaactattattgtcattccaacaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggctctctttacttaccatataatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcatttgaaatt
gatggtcatacttacagcggccaagaattattagatgtgtttgagtatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatcgacggatttagtttggtatttatgg
actgggaaatattcgtcactatttggtaaacgtgccatgactacgtttgagcgatacttt
attgcagataaagcttctcataaagaagaaaagaatccgtactatcatcttcgtgaagat
gtgaatatggttcgtaaaatgctcagtgatttcggattaaatccagatgaaggacgcatt
attaatggtcacacaccagtgaaagaaatcaatggcgaagatcctatcaaggctgatgga
aagatgcttgtcattgatggtggcttttcaaaagcttatcagtcaacaactggcattgca
ggctatacactattgtataattcattcggtatgcaactcgttgcacaccaacaatttaac
gctaaagaaaaaatactttccgaaggtatcgatgaactttctataaagcgcgtcgtagat
aaagaattacaacgtaagaagattcgtgataccaatattggtaaagatcttcaagctcaa
atagatattttgaaaatgttaatgcatgatcgttacttagactaa

DBGET integrated database retrieval system