KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2555Help
Entry
SAUSA300_2555     CDS       T00323                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:saa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:saa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2764288..2764785)
Genome map
AA seq 165 aa AA seqDB search
MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagaaatgtgtatgatatcgaagtaagtgattataaaggcttaacttataaa
ttagaagcatttagaggtaaagtgattttagttgttaatactgcaacagaatgtatatat
agcgaacaattgaaaaaactagagactttatttcaaaaatataaggatcgtgggtttgta
gtgttgagttttccgaataataattttgacaatcgacaaccaggttctaatgaagaaatc
ttgaaaattagtcgtgagaaatttggtgtaacatttccagtgttagctaaaatatctgtg
aacgggaacgatgaacatccgttatttacgcatttaaagaatgaacaaccaggaatcttt
gggtccccaataaaatggaatttcacaaaatttataatcgatcgacaaggaaatgttgta
aatcgattcttgccaatggaagatccattggatatatcgacaaatatagaaatattattg
caagaatcttcatcttaa

DBGET integrated database retrieval system