KEGG   Candidatus Saccharimonas aalborgensis: L336_0078Help
Entry
L336_0078         CDS       T02673                                 

Definition
putative 1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
saal  Candidatus Saccharimonas aalborgensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:saal00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85832..87610
Genome map
AA seq 592 aa AA seqDB search
MSHQIKKHLGAIVRHNGVEFRVWAPFAKNVKLLTPYLGVFDGSNTYDMLSENDGYWSAFV
KDAEVGQNYKFLIDTGNELLTKNDPRGRALTASDNGVSVVVGSDFDWGDDLFMPIPREQQ
IIYELHIGTFNRRDPATTGTFYDAIEKLDYLLDLGINMIEVMPVTSMAYSNGWGYNVTDV
FSIENAYGGRHGLMEFVKACHMRGIGVIIDVVYNHFMSGDLWRFDGWYENDRGGIYFYND
WRGDTPWGARPDYGRAEVRQFLIDSIVMWFNEYRVDGLRLDSTAYMRNTLGYNDDPAHDV
DGAWSLMQDITDVAHRIRPGSIVIAEDTSGNDYITKQRQDGGCGFDAQWGIPFPHAIRKM
LGLGTSWPVDLGEQLLRAYNGDVFQRVIFSDSHDTAANGSTRITSAISPENPNSTRVRQD
TIIASAITLTSPGIPMLLQGQEFLQEGAFTDWQVLEWEKTEQFAGIVKAHQDIIDLRKNT
YGNTSGLLGQSVRVFHRNDQGQVFGYHRWSRGGPGDDVLVLINFGDTEYHEYHLGFPRPG
EWRIRFNSSWQGYNSDFPELTPDSVSTDDSCNLAMDIPARSVLILSQDATAS
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcagatcaaaaaacacttgggggcgattgttcggcataatggtgtcgagttt
cgcgtttgggcgccatttgcaaaaaatgtcaaactccttaccccctatcttggagtattt
gatggcagcaatacctacgatatgctcagcgagaatgacggatactggtcagcattcgtc
aaagatgcagaagtcggccaaaattataagtttttgatcgacaccggcaatgagctgctg
acaaaaaatgacccgcgcggacgcgcactcaccgcaagcgacaatggcgtatcggtggtc
gttgggtcagatttcgactggggcgacgaccttttcatgccaattccaagggagcagcag
attatctacgaacttcatatcggcacctttaatcgccgcgaccccgctacgaccggcacc
ttctacgatgcaatcgaaaaacttgactacctcctagacctcggcatcaacatgatcgag
gtcatgccggttaccagcatggcgtatagcaacggctggggctacaacgtcaccgacgta
ttttcgatcgaaaatgcctatggcgggcgccatggacttatggagtttgttaaagcctgc
catatgagaggtatcggtgtcattattgacgtggtgtacaaccatttcatgagcggcgac
ctatggcgtttcgatggatggtatgaaaacgaccgtggtggcatctacttctacaacgac
tggcgaggcgatactccctggggcgcacgacctgactatggaagagccgaggtgcgacaa
tttctgatcgatagtatcgtgatgtggtttaacgaataccgcgttgatggtctcaggctt
gatagcacggcttatatgcgcaacacgctcggctacaatgatgatcccgcccatgatgtc
gatggcgcctggagcctcatgcaggatattactgatgtggcgcacaggatacggcccggc
tccatcgttatcgcagaagacacctcgggcaatgactatataacgaagcagcgccaggat
ggtggatgtgggtttgacgcgcagtggggtattccttttccacacgctatccggaaaatg
ctcggacttggtacctcatggccagttgatctcggtgagcaactgcttcgagcgtataat
ggtgatgtctttcaacgcgttatctttagtgactctcacgataccgcagccaatggctca
acccgcattaccagcgctatttcaccagaaaatcccaatagcacgagggtgcgtcaggac
acaattattgcgtcagcaatcacccttacgtcacccggtattcctatgctacttcaaggc
caggagtttttgcaggagggtgcattcactgattggcaagtgctcgaatgggaaaaaact
gagcaattcgccggcatcgtgaaagcccaccaagacatcatcgacctccgcaaaaatacc
tacggcaatacaagtgggctacttgggcaatcagttagagtgtttcatagaaacgatcag
ggccaagtgtttggttatcatcgctggagccgaggcgggccaggcgacgatgtgctcgtg
ctgattaattttggtgataccgaatatcacgagtatcatctaggctttccgcgcccaggt
gagtggcgaatacggttcaacagcagctggcaaggctataatagcgactttcccgagtta
actccggacagcgtatccaccgacgatagctgtaatctcgccatggacatcccagcacgc
agcgtgctcattttgtcacaagacgctactgcttcttaa

DBGET integrated database retrieval system