KEGG   Candidatus Saccharimonas aalborgensis: L336_0616Help
Entry
L336_0616         CDS       T02673                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosidase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
saal  Candidatus Saccharimonas aalborgensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:saal03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612942..613856
Genome map
AA seq 304 aa AA seqDB search
MVSPRKCNTSVPELPEVETVRRGLEGLIVGLKITRVRCIDSPKSFPNNPADVREFLYGAR
VVAIRRRAKVLLIELDNDYTLVIHLKMTGQLVYRGEQVFGAGHPNDSLVGELPDRSTRVD
ITFDDGSHLYFNDQRKFGWMKLHPTLEVPNIDFMQRVGPEPLEEAFTSNEFIPRVRRRSN
TTIKAAILDQTVLAGVGNIYADESLWGAKIHPATRVRELTDEQLALLLHEIKYVMNLSIE
KGGSTDRNYVNAEGKRGSYIDFARVFRREGQSCPRCDTIIKKTRVAGRGTHVCPQCQQEH
GDIA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtcagccctagaaagtgcaatacttccgtgcctgaattgccagaggttgaaaccgtc
cgtcgtggcctagaagggcttattgtcggtcttaagattactcgtgtgcgctgcatcgac
tcgccaaagagctttcccaataatcccgcagatgtcagagagtttctttatggtgcacgg
gtcgtggcaatccgccgccgtgcgaaagtactgctgattgagctagataatgactataca
ctagtgatacacctcaaaatgactggacaattagtatatcgcggtgagcaagtttttggt
gcagggcatccaaacgattcacttgttggcgagcttccagatcggagtacgcgtgtcgac
attacgtttgatgacggttcacacctctacttcaatgatcagcgtaaatttggttggatg
aaattgcaccctaccttggaggtgccgaatattgattttatgcagcgggttgggccggaa
ccactcgaagaagcgtttacgagcaacgagtttattccacgtgtccgccgtcgcagcaac
acgacaatcaaagctgctatcctcgaccagacggtgctagcaggagttggcaatatctac
gccgatgagtcactgtggggcgcaaaaatccatccagccacgcgagtacgtgagctaacc
gatgagcaattggcgctgctactccatgagatcaagtacgttatgaatcttagtatcgaa
aaaggtggcagcaccgatcgcaactatgtgaacgctgagggtaagcggggaagttatatt
gattttgctcgtgtgtttcgccgcgaaggacagtcgtgtccacgatgtgatacgatcatt
aagaaaacgagagtcgctgggcggggcactcacgtatgtcctcagtgtcagcaagagcat
ggagatatagcataa

DBGET integrated database retrieval system