KEGG   Candidatus Saccharimonas aalborgensis: L336_0616Help
Entry
L336_0616         CDS       T02673                                 

Gene name
mutM
Definition
(GenBank) formamidopyrimidine-DNA glycosidase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
saal  Candidatus Saccharimonas aalborgensis
Pathway
saal03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:saal00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    L336_0616 (mutM)
Enzymes [BR:saal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     L336_0616 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     L336_0616 (mutM)
DNA repair and recombination proteins [BR:saal03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     L336_0616 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA Auto_anti-p27 Ribosomal_S13 Zn_ribbon_SprT Zn_Tnp_IS1595 zf-TFIIB OrfB_Zn_ribbon zf-UDP DZR
Motif
Other DBs
NCBI-ProteinID: AGL62319
UniProt: R4PN18
Position
612942..613856
Genome map
AA seq 304 aa AA seqDB search
MVSPRKCNTSVPELPEVETVRRGLEGLIVGLKITRVRCIDSPKSFPNNPADVREFLYGAR
VVAIRRRAKVLLIELDNDYTLVIHLKMTGQLVYRGEQVFGAGHPNDSLVGELPDRSTRVD
ITFDDGSHLYFNDQRKFGWMKLHPTLEVPNIDFMQRVGPEPLEEAFTSNEFIPRVRRRSN
TTIKAAILDQTVLAGVGNIYADESLWGAKIHPATRVRELTDEQLALLLHEIKYVMNLSIE
KGGSTDRNYVNAEGKRGSYIDFARVFRREGQSCPRCDTIIKKTRVAGRGTHVCPQCQQEH
GDIA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtcagccctagaaagtgcaatacttccgtgcctgaattgccagaggttgaaaccgtc
cgtcgtggcctagaagggcttattgtcggtcttaagattactcgtgtgcgctgcatcgac
tcgccaaagagctttcccaataatcccgcagatgtcagagagtttctttatggtgcacgg
gtcgtggcaatccgccgccgtgcgaaagtactgctgattgagctagataatgactataca
ctagtgatacacctcaaaatgactggacaattagtatatcgcggtgagcaagtttttggt
gcagggcatccaaacgattcacttgttggcgagcttccagatcggagtacgcgtgtcgac
attacgtttgatgacggttcacacctctacttcaatgatcagcgtaaatttggttggatg
aaattgcaccctaccttggaggtgccgaatattgattttatgcagcgggttgggccggaa
ccactcgaagaagcgtttacgagcaacgagtttattccacgtgtccgccgtcgcagcaac
acgacaatcaaagctgctatcctcgaccagacggtgctagcaggagttggcaatatctac
gccgatgagtcactgtggggcgcaaaaatccatccagccacgcgagtacgtgagctaacc
gatgagcaattggcgctgctactccatgagatcaagtacgttatgaatcttagtatcgaa
aaaggtggcagcaccgatcgcaactatgtgaacgctgagggtaagcggggaagttatatt
gattttgctcgtgtgtttcgccgcgaaggacagtcgtgtccacgatgtgatacgatcatt
aagaaaacgagagtcgctgggcggggcactcacgtatgtcctcagtgtcagcaagagcat
ggagatatagcataa

DBGET integrated database retrieval system