KEGG   Staphylococcus aureus RF122: SAB0205Help
Entry
SAB0205           CDS       T00303                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sab  Staphylococcus aureus RF122
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sab00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
254405..255817
Genome map
AA seq 470 aa AA seqDB search
MWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNHEGIDFYHR
YKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQGIEPVVTL
SHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQMDTSNPIF
LWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISHVPIYPYSC
HPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDFGWQEGDDSILQQGTVDYI
AFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRYTMNVLYDR
YQLPLFIVKNGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIGYTPWGIID
IVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtggggtggcgctcttgccgcaaatcaatttgaaggtggatatgataaaggtggcaaa
ggattaagtgtaattgatgttatgacgagtggtgcacatggcaaagcacgtcagattaca
gaatctatagaccccaatcactattatccaaatcatgaaggtattgatttttatcatcgt
tataaggaagatattgccttgtttaaagaaatgggattgaaatgtttacgtacgtcgatt
gcgtggacacgtatctttccaaatggggatgaagatgtgccaaatgaagaaggactcgcc
ttttatgatcgtatctttgatgaattaattgcacaaggtattgaacctgttgtgacttta
tcacattttgagatgccacttcatttagcgaaacattatggtggatttagaaatagagaa
gttgtcgattattttgtgcattttgcgcgtgttgtatttgaaagatataaagataaagtg
acatattggatgacgtttaatgaaattaataatcagatggacacatcaaatcctatcttt
ttatggacgaattctggggtagcattaacagaaaatgataatcccgaagaagtcttgtat
caagtagcacatcatgaacttttagccagtgctttagcggttcgtcttggtaaagagatt
aatccgaaatttaagattggaacaatgatttcacatgtacccatttatccatattcgtgt
catcctaaagatatgatggaagcacaaattgctaatcgcttacgcttctttttcccggat
gttcaagtaagaggttattatccaagctatgctaaaaaaatgttggcacgaaaaggatat
gattttggatggcaagaaggggacgacagtattttacagcagggcacggttgattatatt
gcctttagttattacatgtctacggctgtaaaacatgatgttgatactacagttgaaaac
aacatcgtcaacggtggtttgaatcattctgtggagaatccgcatatcgcaacgagtgat
tggggttgggcgattgatccagatggcttaagatatacaatgaatgtgttatatgatcgt
tatcagttgccactttttattgtgaaaaatggttttggtgcagttgatgaagtggtagat
ggacatattcatgatgattatcgcattgaatatttaaaagcacatattacagcagcgata
gaagcagttgatcaagatggtgtagatttaatcggttatacgccatggggaatcattgat
attgtttcatttacaactggtgaaatgaagaaacgctatggtttaatatatgttgatcga
gataatgatggtcatggcacgatggaacgcttgaaaaaagattctttctattggtatcaa
caagtgatagcatcaaatggagataaattataa

DBGET integrated database retrieval system