KEGG   Staphylococcus aureus RF122: SAB0208cHelp
Entry
SAB0208c          CDS       T00303                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sab  Staphylococcus aureus RF122
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAB0208c
Enzymes [BR:sab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SAB0208c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(257347..258261)
Genome map
AA seq 304 aa AA seqDB search
MTNKVVIVGSTNVDQFLTVERYAQLGETLHVEEAQKAFGGGKGANQAIATARMQADTTFI
TKIGTDGVADFILEDFKAAHIDTSYIIKTTEAKTGQAFITVNAEGQNTIYVYGGANMTMT
PEDVINAKDAIIDADFVVAQLEVPIPAIISAFEIAKAHGVTTVLNPAPAKALPNELLSLI
DIIVPNETEAELLSGIKVTNEQSMKDNANYFLSLGIKTVLITLGKQGTYFATKNQSQHIE
AYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKASSLTVKKHGAQASIPLLEE
VNQV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaaagttgttattgtaggttcaacgaatgtcgatcaatttttaacagttgaa
agatatgcacaactaggcgaaacattacatgttgaagaagcacaaaaagcattcggcgga
ggtaaaggtgccaaccaggctattgccactgcacgcatgcaagcagacacaacatttatt
actaaaattggcactgatggcgttgctgatttcatcttagaagattttaaagcagctcat
attgatacatcatatattatcaaaacaactgaagcaaaaacgggccaagcctttatcact
gtgaatgcagaaggacaaaacaccatctatgtttatggtggtgcgaatatgacgatgaca
cctgaagatgttattaacgcaaaagacgctataatcgatgcagactttgtcgttgcacaa
ttagaagtacccatcccggctattatatctgcatttgaaattgccaaggcacatggtgtg
acgactgtattaaatcctgcaccagcgaaagcattacctaatgaattattgtcactaatc
gatattattgtgccaaacgaaacagaagccgaattgttatctgggattaaagtaactaat
gaacaatctatgaaagacaatgctaattactttttatctttaggtattaagactgttttg
attacgttaggtaagcaaggtacatattttgctactaaaaatcaaagccaacacatcgaa
gcttataaagtaaatgcgattgatacaactgctgcaggcgacacatttattggtgcattt
gtcagtcgcttaaacaagtcgcaagataacttagcagatgctattgattttggtaataaa
gcgagctctctcactgtaaaaaaacacggcgcgcaagcatctattcctctactagaagaa
gtaaatcaagtttaa

DBGET integrated database retrieval system