KEGG   Staphylococcus aureus RF122: SAB0326Help
Entry
SAB0326           CDS       T00303                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sab  Staphylococcus aureus RF122
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAB0326
   01230 Biosynthesis of amino acids
    SAB0326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAB0326
  Energy metabolism
   00680 Methane metabolism
    SAB0326
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAB0326
Enzymes [BR:sab01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAB0326
Exosome [BR:sab04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAB0326
  Exosomal proteins of melanoma cells
   SAB0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
372858..373439
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADVLCDYFKEKQIEHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNNVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
agatcttatttttgtggacaattagatgtgccgttaacggatactggcacaaaaagtgca
gacgttttatgtgattattttaaagagaaacagattgaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacg
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgtcatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatatcgtcattgttgcacat
caagttgtcattcgttgtttaatggtttattttaataacgtttcgcgggaagaagctgtg
gatttaaaagttgaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system