KEGG   Staphylococcus aureus RF122: SAB0429Help
Entry
SAB0429           CDS       T00303                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sab  Staphylococcus aureus RF122
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAB0429 (recR)
DNA repair and recombination proteins [BR:sab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAB0429 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471704..472300
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatcaaagcttattgatagctttatgaaattgccaggcatt
ggtccaaagacagcccaacgtctggcttttcataccttagatatgaaagaagacgatgtt
gttcagtttgccaaagcattagtagatgttaagagagaattaacatattgtagcgtatgt
ggtcacattactgaaaatgatccatgttatatttgtgaagataagcaaagagatcgttca
gttatttgtgttgtggaagatgacaaagatgtcatagctatggaaaaaatgagagaatac
aaaggtttatatcacgttttacatgggtctatttcgcctatggatggaattggaccagaa
gatattaatattccttcattgattgaacgcttgaaaaacgatgaagttagcgaattaatc
ttagctatgaacccgaacttagagggggaatctacagctatgtatatttctagattagtt
aagcctataggtatcaaagtgacgagattagcacaagggttatcggtaggtggcgattta
gagtatgctgacgaagtaacattatctaaagcaatcgcaggtagaacagaaatgtaa

DBGET integrated database retrieval system