KEGG   Staphylococcus aureus RF122: SAB0648Help
Entry
SAB0648           CDS       T00303                                 

Definition
fructose 1-phosphate kinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
sab  Staphylococcus aureus RF122
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAB0648
Enzymes [BR:sab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SAB0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712329..713249
Genome map
AA seq 306 aa AA seqDB search
MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
GFPGKFIINTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
KNTTSDDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
NKDELEVMFNTTVNSDADVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
SVLDGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtgactttcaatccttcaattgactatgtcatttttacgaatgatttt
aaaattgatggtttgaacagagcaacagcaacatataaattcgctgggggaaaaggtatt
aatgtctcacgtgttttaaagacattggatgttgagtcaactgctttgggatttgcaggt
ggatttcctgggaaattcattataaatacattaaataacagtgcaattcaatcgaatttt
attgaagttgatgaagatacacgtattaatgtgaaattaaaaacaggacaagaaacagaa
atcaatgcaccgggtcctcatataacgtcaacacaatttgaacaactgttacaacaaatt
aaaaatacaacaagcgatgatatagttattgttgctggaagtgtaccaagtagtattcca
agtgatgcgtatgcgcaaattgcacaaattacagcacagacaggtgctaaattagtagtc
gacgctgaaaaagaattggctgaaagcgttttaccatatcatccactatttattaaacct
aataaagatgaattagaagtgatgtttaatacaacagtgaactcagacgcagatgttatt
aaatatggtcgtttgctagttgataaaggtgcgcaatctgttattgtctcacttggcggt
gatggtgctatttatattgataaagaaatcagtattaaagcagttaatccacaagggaaa
gtggttaatacagttggctctggtgatagtacagttgcaggcatggtggctggaattgct
tcaggtttaacgattgaaaaagcattccaacaagcagtcgcatgcggtactgccacggca
tttgatgaggacttagcaacacgggacgctatagaaaaaataaaatcacaagttacgatt
agcgtacttgatggggagtga

DBGET integrated database retrieval system