KEGG   Staphylococcus aureus RF122: SAB1064Help
Entry
SAB1064           CDS       T00303                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic chain A
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00240  Pyrimidine metabolism
sab00250  Alanine, aspartate and glutamate metabolism
sab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAB1064 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAB1064 (pyrB)
Enzymes [BR:sab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SAB1064 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C zinc-ribbon_6
Motif
Other DBs
NCBI-ProteinID: CAI80753
Position
1147266..1148036
Genome map
AA seq 256 aa AA seqDB search
MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
KLGLKTISFETSASSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
GDGSGQHPTQSLLDLMTIYEEYGYFEGLNALICGDIKNSRVARSNYHSLKALGANVMFNS
PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
NKIQEHAIVMHPAHVI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttattatcaatggaacatttatctacagatcaaatatacaaacttatccaa
aaggcaagtcaatttaaatctggtgaacgtcaactaccaaactttgaagggaaatatgtc
gcaaatttattctttgaaaattctactcgaacaaaatgtagttttgaaatggcagaactt
aagctagggttaaaaacgattagctttgaaacatcagcatcatctgtttcaaaaggtgaa
tctttatatgacacatgtaaaactttagaaagtattggctgtgatttattagtcattaga
catccgtttaataactactatgaaaaattagcgaatattaacattccaattgcgaatgct
ggtgatggtagtggacaacatccaacacaaagtttgcttgatttaatgacgatatatgaa
gaatatggatattttgaaggcttgaatgcattgatttgtggagacattaaaaattcacgt
gtcgcacgtagtaattaccatagtttaaaagcattaggtgcaaacgtaatgtttaatagc
ccaaatgcttggattgatgattctttagaagcaccttatgtaaatatagatgatgttata
gaaacagtagatatagttatgttattaagaattcaacatgaaagacatgggcttgcagaa
gaaactagatttgcagcagatgattatcatcaaaagcatggcttaaatgaagtgcgctat
aacaaaatacaagaacatgctattgttatgcatccggcacatgtgatatga

DBGET integrated database retrieval system