KEGG   Staphylococcus aureus RF122: SAB1163Help
Entry
SAB1163           CDS       T00303                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sab  Staphylococcus aureus RF122
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAB1163
Enzymes [BR:sab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SAB1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1266389..1267303
Genome map
AA seq 304 aa AA seqDB search
MNEKQFKLTVQDNTNIEVKVNFTDVDSKGIIHIFHGMAEHMERYDKLAHALSKHGFDVIR
HNHRGHGINIDESTRGHYDDMKRVIGDAFEVAQTVRGNVDKPYIIIGHSMGSVIARLFVE
TYPQYVDGLILSGTGMYPLWKGLPTVKVLQLITKIYGAEKRVEWVNQLVSNSFNKKIRPL
RTQSDWISSNPTEVDNFIKDPYSGFNVSNQLLYQTAYYMLHTSQLKNIKVLNHAMPILLV
SGYDDPLGDYGKGILKLANIYRKAGIKNVKVNLYHHKRHEVLFEKDHDKIWEDLFKWLNQ
FYKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaacaatttaaattaactgtacaagataacacgaatattgaagttaaagtg
aattttacagatgtagattcaaaaggaattattcatatatttcatggtatggctgaacat
atggaacgttacgataaattagcacatgcactttcaaagcatggcttcgatgtgatacgt
cataatcatcgaggacatggtattaatattgatgaatcaacaagagggcattacgatgat
atgaaacgagttatcggtgatgcctttgaagtagcacaaacagtgagaggcaatgttgat
aaaccatacattataatcggacattcaatgggatccgttatagctagattgtttgtagaa
acatatccgcaatatgttgatggtctaattttaagtggtactggtatgtatccattatgg
aaaggattaccaaccgttaaggtgttacaactgattacaaaaatttatggtgctgagaaa
cgggttgaatgggttaaccagttagtatcaaatagttttaataaaaaaatacgtccttta
cgtacacaaagtgattggatttctagtaatccaactgaagtagacaactttattaaagat
ccatatagtggatttaatgtgtcaaatcaattattatatcaaacagcctattatatgcta
catacatcacaattaaaaaatataaaagtgttaaatcatgccatgcctatattattagtt
tcaggatatgacgatcctttaggtgattatggtaaagggattttaaaattggcgaatata
tatagaaaagccggcattaaaaatgttaaagttaatctttatcatcataaacgtcatgaa
gtgttatttgaaaaagatcatgacaaaatttgggaagacttgtttaaatggttgaatcaa
ttttataaaaaataa

DBGET integrated database retrieval system