KEGG   Staphylococcus aureus RF122: SAB1225Help
Entry
SAB1225           CDS       T00303                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01130  Biosynthesis of antibiotics
sab01230  Biosynthesis of amino acids
Module
sab_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAB1225 (trpC)
Enzymes [BR:sab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SAB1225 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C BBE FMN_dh
Motif
Other DBs
NCBI-ProteinID: CAI80914
UniProt: Q2YXU9
Position
1341176..1341958
Genome map
AA seq 260 aa AA seqDB search
MTILAEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKERKLAIIAEIKSKSPT
VNDLPERDLSQQISDYEKYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERVYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKPNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttagcagaaattgttaaatataaacagtcacttttacaaaatgggtattat
caagacaaacttaataccttgaaaagtgtgaagattcagaataaaaaatcttttataaac
gcaattgagaaagaacgaaagctagcaattattgcagaaatcaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcacaacaaatctcagattatgaaaagtatggt
gcaaatgccgtgtccattttaactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacaacaaaaacaacattacccgtattatgcaaagattttattatagatccg
cttcaaattgatgttgctaaacaagctggtgcatctatgattttattgatcgttaacatc
ttatcggataaacaattgaaagatttatataactacgctatatcgcaaaatttagaagtg
ttagttgaagtacatgatcgccatgaattagaacgtgtctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgtcacaaatgtggaacatacaaatact
attttagaaaataaaaaaccaaatcattattatatttctgaaagtggtattcacgatgca
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactaaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system