KEGG   Staphylococcus aureus RF122: SAB1228Help
Entry
SAB1228           CDS       T00303                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sab  Staphylococcus aureus RF122
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAB1228 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAB1228 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAB1228 (trpA)
Enzymes [BR:sab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAB1228 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1343790..1344518
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGDKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPFELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKEIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcgataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcataacgata
gattatattttcgagcaattagaaaaacacggtaatcaaattaagtgtcagtatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gataccggtgtttacggcttaattattcctgatttaccatttgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaattatatcgttagttgcgatgactactgat
gacaaacgtataaaagaaatcgtatcccatgcggaagggtttatttatactgtgacgatg
aatgcgacaacaggacaaaacggtgcgtttcacccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaactccacaacat
gttgcagatataaaagaggttgcagatggtatcgttattggtagtgaaatagtaaaacga
tttaaatctaacacgcgtgaagaaatcattaaatatttacaatctatccagcaaacattg
aataattaa

DBGET integrated database retrieval system