KEGG   Staphylococcus aureus RF122: SAB1268cHelp
Entry
SAB1268c          CDS       T00303                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sab  Staphylococcus aureus RF122
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAB1268c (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAB1268c (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    SAB1268c (odhB)
Enzymes [BR:sab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAB1268c (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1383021..1384289)
Genome map
AA seq 422 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAVIGEGSGNASKENSNDNTPQQNEETNNKKEETTNKSADNAEVNQTND
YNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEE
KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacgtaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgcc
agtgaaggcgacactgtagaagttggacaagcaattgctgtcatcggcgaaggtagtggc
aatgcttctaaagaaaatagcaacgacaatactccacaacaaaatgaagaaacaaataat
aaaaaagaagaaacaacaaataaatcggcagataatgctgaagtcaatcaaacaaatgat
tacaatcagcagcgtgttaatgctacaccttctgcgcgtcgatatgctcgtgaaaatggt
gtgaatcttgctgaagtaagtccgaaaacaaatgatgttgttcgtaaagaagatattgat
aagaaacaacaggcaccggcatcaacacaaacaacacaacaagcacctgcaaaagaagag
aaaaaatacaatcaatatcctacaaaaccagtgattcgtgaaaaaatgtcacgcagaaag
aaaacagctgccaaaaaattattagaggtatctaataatacagctatgttaacaacattt
aacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaacaatttatg
aaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgtagca
gctttgaaaaagtatccagaagttaatgcagaaatcgacggcgacgacatgattacgaaa
caatattatgatattggtgtagctgtttctacagatgatggattattagtaccattcgta
agagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagcagtt
aaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgattaca
aatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagctgca
atcttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatcgaa
aatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaagaa
gcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttattatta
gaatcttaa

DBGET integrated database retrieval system