KEGG   Staphylococcus aureus RF122: SAB1296cHelp
Entry
SAB1296c          CDS       T00303                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sab  Staphylococcus aureus RF122
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAB1296c
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAB1296c
  Lipid metabolism
   00071 Fatty acid degradation
    SAB1296c
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAB1296c
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAB1296c
   00626 Naphthalene degradation
    SAB1296c
Enzymes [BR:sab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAB1296c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1418565..1419536)
Genome map
AA seq 323 aa AA seqDB search
MFNAVVVRKSASNVSYKVETVDESHLSKGDVLVKVVYSSINYKDMLALQYKGGVIRDYPM
IPGIDFAGIVESSSNDKFKEGDNVLVTGYDVGVTHTGGFSEYAQVPGEWIVPLPQEMSIK
ESMVYGTAGFTAALSIFELEKYGMNIKSQPEILVSGATGGVGSVAIQILRKIGYENITAI
VRKEKQIEIAKKLGAKQVIIIEDDNKPLKKGIFDYFLDTVGSNVTLYGLKRLNYQGVATV
CGNVAGNSLNANILPFILRGIKLIGIDSVYVDHNIREDIWSKLANEWNIGNSLLYNEIGF
EEFYKTIDQLLKGQHLGRTILKV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatgcggtagtagtgagaaaaagtgcatcaaatgttagttataaagtagaaacc
gttgatgaatctcatttatcgaagggtgatgtcttagtaaaagtggtatactcttcaata
aattataaggatatgctagctttacaatataaaggcggtgtaattagagattatcctatg
attcctggtatagattttgcaggtattgttgaatcaagttcgaatgataagtttaaagaa
ggcgataatgtattagttactggttatgatgtcggcgtgacacatacaggtggattttca
gaatatgcacaagtgcctggagagtggattgttcctcttccccaagaaatgtctattaaa
gagtctatggtatatggcacagccggttttacggcagcattatcaatttttgaactagaa
aaatatggaatgaatatcaaatcacaacctgaaattttagtgtctggggctacaggtggt
gtgggcagtgttgctatacaaattttacgtaaaattggatatgaaaatatcactgctatc
gtaagaaaagaaaagcaaatagaaatcgcaaaaaaattaggtgcaaaacaagtaataata
attgaagatgataataaaccacttaaaaaaggtatttttgattatttcctagatacagtg
gggagtaatgtaacattatacggtttaaaacgtcttaattatcaaggtgttgctactgta
tgtggaaatgtagcaggaaattcacttaacgctaatatattaccgtttattcttagaggt
attaaattaattggcattgattctgtatatgttgatcataatatccgtgaagatatatgg
agtaagttagcaaatgaatggaatataggaaattcacttctatacaatgaaattggattt
gaagaattctataaaacgatagatcagcttttaaaaggacaacatttaggaagaactatt
ttaaaagtataa

DBGET integrated database retrieval system