KEGG   Staphylococcus aureus RF122: SAB1529cHelp
Entry
SAB1529c          CDS       T00303                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.24)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sab  Staphylococcus aureus RF122
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAB1529c (hemD)
Enzymes [BR:sab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SAB1529c (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1648962..1649630)
Genome map
AA seq 222 aa AA seqDB search
MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
KGINVDNIAVIGSKTAQYCESLGIQVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
LSAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagttgtagttatgacacaaacaaatgacatgcaaagtgatttagtatcaatt
attcacaaaccctttattgatataaagccactaaattttgatattcatttgttaaatcaa
cgctatgactggcttattttttcatctaaaaatgctgtgaaattcttttataaatatcta
aaaggaattaatgttgataacattgctgtgataggaagtaagacagcgcaatattgtgaa
tcacttggcattcaagttgattttatgccaaacgacttttctcaagaaggatttttaaaa
tcatttaatcaaactaaccaaaaaatacttttgccttcaagtgaattggcgagaccattg
ttatcagcagcgttatctaaagataatgaagttgttaaaatagatttatatacttcagtg
cctaacaaacaaaatatacaagatgttaaagaaatgatagaacatcaacaaatcgatgca
ttaacattttcaagttcgtcggcagtacgttattattttaatgaaggatttgtaccaaaa
ttcaagtcgtattttgctattggagaacaaacagcacggaccattaaatcatatcaacaa
ccagtaacaattgcagaaattcaaacacttgaatcactaattgaaaagattttagaaagt
aggggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system