KEGG   Staphylococcus aureus RF122: SAB1605cHelp
Entry
SAB1605c          CDS       T00303                                 

Definition
endo-1,4-beta-glucanase (EC:3.2.1.4)
Orthology
K01261  
glutamyl aminopeptidase [EC:3.4.11.7]
Organism
sab  Staphylococcus aureus RF122
Brite
Enzymes [BR:sab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     SAB1605c
Peptidases [BR:sab01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   SAB1605c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1744104..1745180)
Genome map
AA seq 358 aa AA seqDB search
MNINKKVTLQRIQTLTELHGAPGFEEEVKNYMTQQMAPYVDEFIENRMGGFFGVKKSKNP
NAKRVMIAAHMDEIGFMITNITKNGMIQFTNLGGVANDIWQGQRLVIKNRNGDKIIGVVS
NIPKHFRTGSEGAPEIKDLTLDIGAQNEDEVRERGIDIGDTIVPHTPFTQLSEHRYSAKA
WDNRYGCVLAIEILELLKDIELDVDLYVGANVQEEVGLRGAKASAEMIDPDVAFVVDCSP
ANDVKGNQPLSGELGKGTLIRIKDGTMILKPAFRDYLLKLVEAHDIEYQYYMSPGGTDGG
EIHKANIGIPTAVIGVCARYIHSTDSVFDIRDYFAARSLLSETICNLDNNQIETLQYK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaataaaaaagtaacattacaacgaattcaaactttaactgagcttcatggg
gcaccaggttttgaagaagaagtaaaaaattatatgactcagcaaatggcgccgtacgta
gatgaatttattgaaaatcgtatgggtggtttttttggtgtgaaaaaatctaaaaatcca
aatgcaaaacgtgtaatgattgcagcacatatggatgaaattggatttatgattacaaac
atcactaaaaatggaatgattcaattcacaaatttaggtggtgttgcaaatgatatttgg
caaggacaacgcttagtaattaaaaatagaaatggcgataaaattatcggtgttgtttct
aatatacctaaacattttcgtactggtagtgaaggtgcaccggaaattaaagatttaaca
ttagatataggtgctcaaaatgaagatgaagtgcgtgagcgtggaatagatataggagat
acaattgtacctcacacgccattcacacagttatctgaacatcgttatagtgctaaagca
tgggataatcgttatggttgtgtcttggcaattgaaatactagaattattaaaagatata
gaattagatgtagacttgtatgttggcgcaaatgttcaagaagaggttggattacggggt
gcgaaagcatctgcagagatgatagacccagacgttgcatttgtagtcgattgttcacct
gccaatgacgttaaaggtaatcaaccattatccggtgaacttggtaaaggtacgttaatt
cgcataaaagacggtacaatgattttaaagcctgcatttagagactatttattaaagtta
gtagaagcacatgacattgaatatcaatactatatgtcaccaggtggaacagatggtgga
gaaattcataaagctaatattggtattccgactgcagttattggtgtatgtgcacgatat
attcatagtacagactcagtatttgatataagagactattttgcagctagatctttactt
tcagaaaccatttgtaatttagataataatcaaatagaaacattacaatataaataa

DBGET integrated database retrieval system