KEGG   Staphylococcus aureus RF122: SAB2338cHelp
Entry
SAB2338c          CDS       T00303                                 

Definition
endo-1,4-beta-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sab  Staphylococcus aureus RF122
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sab00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2473728..2474804)
Genome map
AA seq 358 aa AA seqDB search
MNQLVKLLKHLTDVNGIAGYEMQVKEAMRSYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
VLTPEERKKPMEIKNMFIDIGVSSKEEAEKAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
NRYGCALAVEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVANRHNIEVQWDTTPGGGTDA
GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDETYKNIMW
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagttagtcaaattacttaaacatttaacagatgtaaacggcattgctggttat
gaaatgcaagttaaagaagcaatgcgtagctatatagagcctgtcagtgatcaaattatt
gaagataatttgggtggtatttttggaaagaaaaatgctgagaatggtcaatactcaatt
atgatttctggtcatatggatgaagttggttttatggtaacaaagattgataaacatggt
tttatttcatttacgccagttggtggatggtggaatcaagtcatgctatctcaaaaagta
acgattacaacagattcgggcaaagaaattagaggtatcatcggttctaaaccgccacat
gtcttaacgcctgaagaacgtaaaaagccaatggaaatcaaaaatatgtttatagatatt
ggtgttagtagcaaggaagaagctgaaaaagctggcgttgaagtaggcaatatggttacg
ccatatagtgaatttgaagtgcttgcaaatgataaatatttaactgcgaaagcatttgat
aatcgctatggctgtgcattagctgttgaggtattaaaacgtttaaaagatgaaaatatt
ggcattaacttatacagtggtgccacagtgcaagaagaagttggtttgcgtggtgcgaaa
gtggcagcgaatacaattaaaccagatttggcgatagccgtcgatgtgggtattgcttat
gatacaccaggtatgtcaggtcaaacgagtgatagtaaactaggcggtggtccagttgtt
attatgatggatgctacaagtattgcgcaccaaggtttgcgcaagcatattaaagatgta
gctaacagacataacatcgaagtacaatgggatacgacaccaggtggaggtacagatgcg
ggaagtattcatgtcgcaaatgaaggtattccaacgatgacaataggtgtcacgttacga
tacatgcactctaatgtatcggtactcaatgtggatgattatgaaaattctatccgtctt
gttactgaaattgtccgttcattgaatgatgaaacttataaaaatatcatgtggtag

DBGET integrated database retrieval system