KEGG   Staphylococcus aureus RF122: SAB2386Help
Entry
SAB2386           CDS       T00303                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sab  Staphylococcus aureus RF122
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sab00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sab00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sab02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2522783..2523394
Genome map
AA seq 203 aa AA seqDB search
MEQIITEFISRFGYAAIFILILLENVLPIVPSEIILTFAGLMSVKSHLSILTLFIIATIA
SFIGLLILYYICRLISEERLYRFIDRHGKWIKLKSKDLKRANDWFKKYGVWAVFICRFIP
VLRVLITIPAGVNRMNVVTFTVISLIGTTIWNFGLILLGRTLSDSFGMLMTGLHTYSRIM
YVVIIIAVIYFAIRYIGKRKRVK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaattatcactgaatttattagtcgttttgggtatgcagccatttttatatta
attttattagaaaatgttttacctatcgtaccatcggaaattattctgacatttgctggt
cttatgtctgttaaatcacatttatcaattttaaccttatttattattgcaaccatcgca
tcgtttatagggctgttaattttatattatatctgtcgtttgatttcagaagaacgtcta
tatcgctttattgatcgacacggtaagtggattaaattgaaaagtaaggatttaaagcga
gcaaatgattggtttaaaaagtatggcgtatgggctgtatttatctgtcgtttcatacct
gtattacgtgtattgattaccattccagccggtgtaaaccgcatgaatgttgtgacattt
accgttatttcattaataggtacaacaatttggaatttcggtttaattttactaggacgc
acgttgagcgatagctttggtatgttgatgactggtcttcatacatattcacgtattatg
tatgttgtcatcattatcgcagtcatttactttgctatacgttacattggcaaacgtaag
agagtaaaataa

DBGET integrated database retrieval system