KEGG   Staphylococcus aureus RF122: SAB2386Help
Entry
SAB2386           CDS       T00303                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sab  Staphylococcus aureus RF122
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAB2386
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAB2386
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAB2386
Enzymes [BR:sab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SAB2386
Exosome [BR:sab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAB2386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2522783..2523394
Genome map
AA seq 203 aa AA seqDB search
MEQIITEFISRFGYAAIFILILLENVLPIVPSEIILTFAGLMSVKSHLSILTLFIIATIA
SFIGLLILYYICRLISEERLYRFIDRHGKWIKLKSKDLKRANDWFKKYGVWAVFICRFIP
VLRVLITIPAGVNRMNVVTFTVISLIGTTIWNFGLILLGRTLSDSFGMLMTGLHTYSRIM
YVVIIIAVIYFAIRYIGKRKRVK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaattatcactgaatttattagtcgttttgggtatgcagccatttttatatta
attttattagaaaatgttttacctatcgtaccatcggaaattattctgacatttgctggt
cttatgtctgttaaatcacatttatcaattttaaccttatttattattgcaaccatcgca
tcgtttatagggctgttaattttatattatatctgtcgtttgatttcagaagaacgtcta
tatcgctttattgatcgacacggtaagtggattaaattgaaaagtaaggatttaaagcga
gcaaatgattggtttaaaaagtatggcgtatgggctgtatttatctgtcgtttcatacct
gtattacgtgtattgattaccattccagccggtgtaaaccgcatgaatgttgtgacattt
accgttatttcattaataggtacaacaatttggaatttcggtttaattttactaggacgc
acgttgagcgatagctttggtatgttgatgactggtcttcatacatattcacgtattatg
tatgttgtcatcattatcgcagtcatttactttgctatacgttacattggcaaacgtaag
agagtaaaataa

DBGET integrated database retrieval system