KEGG   Staphylococcus aureus RF122: SAB2390Help
Entry
SAB2390           CDS       T00303                                 

Definition
(GenBank) fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00010  Glycolysis / Gluconeogenesis
sab00030  Pentose phosphate pathway
sab00051  Fructose and mannose metabolism
sab00680  Methane metabolism
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01120  Microbial metabolism in diverse environments
sab01130  Biosynthesis of antibiotics
sab01200  Carbon metabolism
Module
sab_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAB2390
   00030 Pentose phosphate pathway
    SAB2390
   00051 Fructose and mannose metabolism
    SAB2390
  Energy metabolism
   00680 Methane metabolism
    SAB2390
Enzymes [BR:sab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SAB2390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 GP24_25
Motif
Other DBs
NCBI-ProteinID: CAI82078
UniProt: Q2YW94
Position
2525882..2527846
Genome map
AA seq 654 aa AA seqDB search
MTQITERELKKKYLDLLSQRFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKDKLSTKELNDLTALVYYPEDKLQLIKCDFQNYGQLNVWYITT
IEHLIQLIKYCSSKYTRSKLRRALPEQYVFIVEELLYKNNEFKNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIVEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPVIKRRPNFEMDERLVLEKVNYDTNEITVYRKT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPCNGN
LLIHGCIPVDENGEMESFEIDGQTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIEELSIKRIVDKELQRKKIRNTNKGKELQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaagagaattaaaaaagaaatatttggatttattatctcaacgt
ttcgatactccagaaaaacttgcgactgaaattattaatttagaatctattttagaatta
cctaaaggtacggagcatttcgtcagcgatttacatggtgaatatgaagctttccaacac
gtattacgcaacggttctgggaacgtgcgagcgaaaattaatgatattttcaaagacaag
ttatcaacgaaagaacttaacgatttgactgcccttgtttactatccagaagacaaattg
caacttattaaatgcgattttcaaaattatggacaattaaatgtttggtatattacgacg
attgaacacctcattcagctaattaaatattgttcttcaaaatatacgcgttcaaaactt
cgacgtgccttgccggagcaatacgttttcatcgtagaagagttattatataagaacaac
gaatttaaaaataaaaaatcttactacgaaacacttgtaaaccaagtgattgagcttaag
caagcggatgatttaattatagggcttgcttattctgtacaacgcttagtcgtcgatcat
ttacacgttgtcggtgatatttatgatcgtggcccgcaaccagataaaatcatggacacg
ctgattaattatcattctctggatattcaatggggtaatcatgatgtgctatgggttggt
gcttatgcagggtctaaagtatgtttagctaatttactacgtatttgtgcacgttatgac
aatctagatatcgttgaagatgcttacggtattaatttaagacctttgctaacattagcc
gaaaagtactatgatgcagataatcctgcttttaaacctaaaaaaagacctgacaaacat
gaacgtttaacacaacgcgaagaaagtcagattactaaaattcaccaagctattgcgatg
attcaattcaaactggaaataccggttattaagcgccgtccaaactttgaaatggacgaa
cgacttgtacttgaaaaagttaattatgatactaatgaaataacagtatacagaaaaaca
tatccattaaaagatacatgcttccaaactgttaaccgtgataacccagcagaattacta
cctgaagaagaagaagtcatgaacaaactattattgtcattccagcaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggctcactttacttaccttgtaatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcattcgaaatt
gatggtcagacatacagtggccaagagttattagatgtgtttgaatatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatccactgatttagtttggtatttatgg
actgggaaatattcttcactatttggtaaacgtgcgatgactacgtttgaacgatacttt
attgcagataaagcttctcataaagaagaaaagaatccgtactatcatcttcgtgaagat
gtgaatatggttcgtaaaatgctcagcgatttcggattaaatccagatgaaggacgcatt
attaatggtcacacaccagtgaaagaaattaatggggaagatcctatcaaggctgatgga
aagatgcttgtcattgatggcggcttttcaaaagcttatcagtcaacaactggcattgca
ggctatacattgttgtataattcattcggaatgcaactcgttgcacatcaacaatttaac
gcaaaagaaaaaattctttccgaaggtatcgaggaactgtcaattaaacgtattgttgat
aaagaattacaacgtaaaaaaatccgcaatacaaataaaggtaaagagcttcaagctcaa
atagatattttgaaaatgttaatgcatgatcgttacttagactaa

DBGET integrated database retrieval system