KEGG   Staphylococcus aureus RF122: SAB2554cHelp
Entry
SAB2554c          CDS       T00303                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00340  Histidine metabolism
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sab00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SAB2554c (hisD)
Enzymes [BR:sab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SAB2554c (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HALZ DUF4435 MbeB_N FadA DUF883 DUF4370
Motif
Other DBs
NCBI-ProteinID: CAI82242
UniProt: Q2YZB4
Position
complement(2708871..2710121)
Genome map
AA seq 416 aa AA seqDB search
MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHE
QIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEKSVECYEIYHPLESVGIYVPG
GKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVNQVFQVGGAQSI
AALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDDTADLDAIV
YDVFAQAEHDELARTYVISEDAQVLKDLESRITKALPNVDRYDIVSKSIANQHYLIHASN
FDDACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTN
RTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagatgagtca
ttgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataaggctttg
aaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagtcatgaa
caaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaacaaagt
tatgaaagaattaaagcatatcaagaaagtattaagcagacgaatcaacagttagaaaaa
tcagtggagtgttatgaaatataccatccactagaaagtgtgggtatttatgtgcctggt
ggcaaagcaagttatccatcaacggttctaatgacagcgactttagcacaagtagcgggt
gtagaaaatattgttgttgtgacaccacctcaacctaacggagtatcccaagaggtatta
gctgcatgttatattacgcaagttaatcaagtgtttcaagttggtggtgctcaaagtatt
gctgcattgacttatggaacagaaacgatacctaaagttgataagattgtaggtccaggt
aaccaatttgttgcatatgccaaaaaatatttatttggacaggtaggtattgatcaaatt
gcaggaccaacagaaatagcactgattattgatgacaccgcagatttagatgccatcgta
tatgatgtatttgcgcaagcagaacatgatgaattagcacgtacatatgtcattagtgaa
gatgcgcaagtccttaaagatttagaatcacgtattactaaagcattgcctaatgtggac
agatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgctagtaat
tttgatgacgcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgattcaaaca
gtaaatcctcaaccatatattgaaaaagtgaaatatgtgggcgcattgtttattggacat
tattcgccagaggttataggtgattatgtcgctggacctagtcatgtattacctacaaat
agaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaacacggtc
atccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatattgctcat
gttgaagcattatacaatcaccaacagtccattttaatacgtcagtcttag

DBGET integrated database retrieval system