KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0257Help
Entry
SACOL0257         CDS       T00225                                 

Definition
ribose operon repressor
Orthology
K02529  
LacI family transcriptional regulator
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(296295..297293)
Genome map
AA seq 332 aa AA seqDB search
MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSERLGYAPNKHAKQLRGS
KIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDLYDNIKHLIDRGIDGLI
IAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQGGQLAAQHLIELGHNHM
IIVAPYDMMANMSTRVAGFVDTLRANQLPEPQIVHTELSKRGGLTIVDDIMVQSATAIFA
INDELAIGILRGLIEHGISIPKDISLIGYDDIDYAAYVSPPLTTVAQPITDIGKTSLTLL
LQRLQHLDKSIDMIELPTTLKIRATTGYHLSN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgtcaattaaagatgttgctagagaagctggtgtatcagttacaactgtg
tcacatattttaaatcataatgatagtcgtttttccgcaacaacgataaaaaacgtacat
gctgtttcagaacgtttaggctatgcccctaataaacatgcaaaacaattgcgcggcagt
aaaattcaaactattggcgtcattttgcctagcttaacaaatccgtttttctcagcactg
atgcaaagtattcatgaccataaaccatctgatgttgatttatgctttttaacatctaca
gcaactgatttgtatgacaatattaaacatttaattgatcgaggtattgacggattaatt
atcgcacaatacatatcatccccggacgccctaaataactatctaaagaaacatcatgta
ccttatgtcgtactggatcaaaatgaccatcaaggctatacagattttgttcggacaaat
gaatatcaaggtggacaacttgcagcacaacatttaatagaactcggtcacaaccatatg
ataattgttgcaccatatgacatgatggcgaatatgtcgactcgtgtcgctggatttgtc
gatactttgcgcgcgaatcaattgccagaaccacaaatcgtccatactgaattatctaag
cgcggtgggctaaccattgttgatgacatcatggttcaatctgccactgcaatcttcgct
attaacgatgaactcgctattggcattttacgaggactaattgaacatggcatcagtatc
ccgaaagatatctcattaataggttatgacgacattgattatgcagcgtacgtctcgcca
cctttaactactgtggcacaacctataactgatattggcaaaacatctttaaccttatta
cttcaacgattacagcacttagataaatccattgatatgattgaattaccaacgacttta
aaaattcgtgcaacaactggctatcatctttcaaactaa

DBGET integrated database retrieval system