KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0257Help
Entry
SACOL0257         CDS       T00225                                 

Definition
ribose operon repressor
Orthology
K02529  
LacI family transcriptional regulator
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Brite
Transcription factors [BR:sac03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    SACOL0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(296295..297293)
Genome map
AA seq 332 aa AA seqDB search
MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSERLGYAPNKHAKQLRGS
KIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDLYDNIKHLIDRGIDGLI
IAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQGGQLAAQHLIELGHNHM
IIVAPYDMMANMSTRVAGFVDTLRANQLPEPQIVHTELSKRGGLTIVDDIMVQSATAIFA
INDELAIGILRGLIEHGISIPKDISLIGYDDIDYAAYVSPPLTTVAQPITDIGKTSLTLL
LQRLQHLDKSIDMIELPTTLKIRATTGYHLSN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgtcaattaaagatgttgctagagaagctggtgtatcagttacaactgtg
tcacatattttaaatcataatgatagtcgtttttccgcaacaacgataaaaaacgtacat
gctgtttcagaacgtttaggctatgcccctaataaacatgcaaaacaattgcgcggcagt
aaaattcaaactattggcgtcattttgcctagcttaacaaatccgtttttctcagcactg
atgcaaagtattcatgaccataaaccatctgatgttgatttatgctttttaacatctaca
gcaactgatttgtatgacaatattaaacatttaattgatcgaggtattgacggattaatt
atcgcacaatacatatcatccccggacgccctaaataactatctaaagaaacatcatgta
ccttatgtcgtactggatcaaaatgaccatcaaggctatacagattttgttcggacaaat
gaatatcaaggtggacaacttgcagcacaacatttaatagaactcggtcacaaccatatg
ataattgttgcaccatatgacatgatggcgaatatgtcgactcgtgtcgctggatttgtc
gatactttgcgcgcgaatcaattgccagaaccacaaatcgtccatactgaattatctaag
cgcggtgggctaaccattgttgatgacatcatggttcaatctgccactgcaatcttcgct
attaacgatgaactcgctattggcattttacgaggactaattgaacatggcatcagtatc
ccgaaagatatctcattaataggttatgacgacattgattatgcagcgtacgtctcgcca
cctttaactactgtggcacaacctataactgatattggcaaaacatctttaaccttatta
cttcaacgattacagcacttagataaatccattgatatgattgaattaccaacgacttta
aaaattcgtgcaacaactggctatcatctttcaaactaa

DBGET integrated database retrieval system