KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0560Help
Entry
SACOL0560         CDS       T00225                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sac00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
569392..569868
Genome map
AA seq 158 aa AA seqDB search
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISPIYETAPVGYTEQPNFLNLCVE
IQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNE
RAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagcatacttaggattaggtagtaatattggtgatagagaaagccagttaaac
gatgctataaagattttgaatgaatatgatggtattaacgtatctaatatttctccgatt
tatgaaacagcaccagttgggtatactgagcaacctaactttttaaatttgtgtgttgaa
attcaaacaacactcacagtattacaactgttggaatgttgtttgaagacagaagaatgt
ttacaccgtattagaaaggaacgatggggtcctagaactttagatgtggatattttgttg
tatggagaagaaatgatagatttaccaaaactgtcggtgccacatccgagaatgaatgaa
cgtgcatttgttttaatcccattaaatgatatagcagcaaatgtcgtagaaccacgttcg
aaattgaaagtgaaagatttagtttttgtcgatgacagtgtaaagagatataaataa

DBGET integrated database retrieval system