KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL0603Help
Entry
SACOL0603         CDS       T00225                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sac00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sac00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(628737..629399)
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
CPVVRININEYDIHKDPESLNPMINKIARIIQTYRQVDTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattacggtattccacaaaatgccattataaccattgcaggtacagttggtgtt
ggaaaatcaacactaacgcaagcacttgcagataaattaaactttaaaacgtcttttgaa
aatgtcgaacataatccatatttagataaattttacagcgattttgaacgatggagtttc
catttgcaaatttacttcttagctgaacgttttaaagaacaaaagcgtatgtttgaatat
ggtggtggctttgtccaagatcgatcaatttatgaagatgttgatatttttgcaaaaatg
catgaagaagaaggcacaatgagtaaagaagatttcaaaacatattcagacttatttaat
gccatggtcatgacaccttattttcctaaacctgatgtaatgatttatttagaatgtaac
tatgatgaggtcattgatcgtattattgaacgtggtcgcgaaatggaaattaatacagac
cctgaatactggaaaaagctatttaaacgctatgacgattggattaatagctttaatgca
tgtccagttgtacgtatcaatattaatgaatatgatatccataaggaccccgaatcttta
aatcctatgataaacaaaattgctcgaattattcaaacatatcgacaagtagatacacga
taa

DBGET integrated database retrieval system