KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1104Help
Entry
SACOL1104         CDS       T00225                                 

Gene name
pdhC
Definition
branched-chain alpha-keto acid dehydrogenase E2 (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACOL1104 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACOL1104 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SACOL1104 (pdhC)
   00620 Pyruvate metabolism
    SACOL1104 (pdhC)
Enzymes [BR:sac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SACOL1104 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1114254..1115546
Genome map
AA seq 430 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
EVAETPAAPAAVTLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
NNPELLLMEG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgta
aaatggtttgttaaagctggagatactattgaagaagacgatgttttagctgaggtacaa
aacgataaatcagtagtagaaatcccatcaccagtatctggtactgtagaagaagttatg
gtagaagaaggtacagtagctgtagttggtgacgttattgttaaaatcgatgcacctgat
gcagaagatatgcaatttaaaggtcatgatgatgattcatcatctaaagaagaacctgcg
aaagaggaagcgccagcagagcaagcacctgtagctactcaaactgaagaagtagatgaa
aacagaactgttaaagcaatgccttcagtacgtaaatacgcacgtgaaaaaggtgttaac
attaaagcagtttctggatctggtaaaaatggtcgtattacaaaagaagatgtagatgca
tacttaaatggtggtgcaccaacagcttcaaatgaatcagctgcttcagctacaagtgaa
gaagttgctgaaactcctgcagcacctgcagcagtaacattagaaggcgacttcccagaa
acaactgaaaaaatccctgctatgcgtagagcaattgcgaaagcaatggttaactctaag
catactgcacctcatgtaacattaatggatgaaattgatgttcaagcattatgggatcac
cgtaagaaatttaaagaaatcgcagctgaacaaggtactaagttaacattcttaccttat
gttgttaaagcacttgtttctgcattgaaaaaatacccagcacttaacacttcattcaat
gaagaagctggtgaaatcgttcataaacattactggaatatcggtattgcagcagacact
gatagaggattattagtacctgttgttaaacatgctgatcgtaagtctattttccaaatt
tcagatgaaattaatgaattagctgttaaagcacgtgatggtaaattaacagccgatgaa
atgaaaggtgctacatgcacaatcagtaatatcggttcagctggtggacaatggttcact
ccagttatcaatcacccagaagtagcaatcttaggaattggccgtattgctcaaaaacct
atcgttaaagatggagaaattgttgcagcaccagtattagcattatcattaagctttgac
cacagacaaattgatggtgcaactggccaaaatgcaatgaatcacattaaacgtttatta
aataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system