KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1148Help
Entry
SACOL1148         CDS       T00225                                 

Gene name
pheS
Definition
phenylalanyl-tRNA synthetase subunit alpha (EC:6.1.1.20)
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sac00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1155545..1156603
Genome map
AA seq 352 aa AA seqDB search
MSEQQTMSELKQQALVDINEANDERALQEVKVKYLGKKGSVSGLMKLMKDLPNEDKPAFG
QKVNELRQTIQNELDERQQMLVKEKLNKQLAEETIDVSLPGRHIEIGSKHPLTRTIEEIE
DLFLGLGYEIVNGYEVEQDHYNFEMLNLPKSHPARDMQDSFYITDEILLRTHTSPVQART
MESRHGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNVKMSDLKGTLELLAKKL
FGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMA
GFDSSEYSGFAFGMGPDRIAMLKYGIEDIRHFYTNDVRFLDQFKAVEDRGDM
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacaacaaacaatgtcagagttaaaacaacaagcgcttgtagatattaatgaa
gcaaatgatgaacgtgcactgcaagaagttaaagtgaaatacttaggtaaaaaagggtca
gttagcggactaatgaaattgatgaaggatttgccgaatgaagataaacctgcgtttggt
caaaaagtgaatgaattgcgtcaaacaattcaaaatgaattagatgaaagacaacagatg
ttagttaaagaaaaattaaataagcaattggctgaagaaacaattgatgtatcattacca
ggtcgtcatattgaaatcggttcaaagcatccattaacacgtacaatagaagaaattgaa
gacttattcttaggtttaggttatgaaattgtgaatggatatgaagttgaacaagatcat
tataacttcgaaatgctgaatttacctaaatcacaccctgcacgtgatatgcaagatagt
ttctatattacggatgaaattttattacgtacgcatacatcaccagtgcaggcacgtacg
atggaatcacgtcatggtcaaggtccagttaaaattatttgccctggtaaagtgtatcgt
cgtgactctgatgatgcgacacatagtcatcaatttacacaaatcgaaggattagttgtt
gataaaaacgttaaaatgagtgatttgaaaggtactttagaattgttagctaagaaatta
tttggtgctgatcgtgaaattcgtttacgtccaagttacttcccattcactgaaccttct
gtagaagttgatgtgtcatgttttaaatgtaaaggaaaaggttgtaatgtgtgtaaacac
acaggatggattgaaattttaggtgctggaatggtacatcctaatgtattagaaatggct
ggttttgattcttcagagtactctggatttgcatttggtatgggaccagaccgtattgca
atgttgaaatatggtatagaagatattcgtcatttctatactaatgatgtgagattttta
gatcaatttaaagcggtagaagatagaggtgacatgtaa

DBGET integrated database retrieval system