KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1212Help
Entry
SACOL1212         CDS       T00225                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sac00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sac00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1219448..1220329
Genome map
AA seq 293 aa AA seqDB search
MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttattatcaatggaacatttatctacagatcaaatatacaaacttatccaa
aaggcaagtcaatttaaatctggtgaacgtcaactaccaaactttgaagggaaatatgtc
gcaaatttattctttgaaaattctactcgaacaaaatgtagttttgaaatggcagaactt
aagctagggttaaaaacgattagctttgaaacatcaacatcatctgtttcaaaaggtgaa
tctttatatgacacatgtaaaactttagaaagtattggctgtgatttattagtcattaga
catccgtttaataactactatgaaaaattagcgaatattaacatcccaattgcgaatgct
ggtgatggtagtggacaacatccaacacaaagtttacttgatttaatgacgatatatgaa
gaatatggatattttgaaggcttgaatgtattgatttgtggagacattaaaaattcacgt
gtcgcacgtagtaattaccatagtttaaaagcattaggtgcaaacgtaatgtttaatagc
ccaaatgcttggattgatgattctttagaagcaccttatgtaaatatagatgatgttata
gaaacagtagatatagttatgttattaagaattcaacatgaaaggcatgggcttgcagaa
gaaactagatttgcagcagatgattatcatcaaaagcatggcttaaatgaagtacgctat
aacaaattacaagaacatgctattgttatgcatccggcacctgtgaatagaggagtagaa
atacaaagcgatttagtagaagcttcaaaatcaagaatttttaagcaaatggaaaatggc
gtttacttaagaatggcagtcattgatgaattattaaaatag

DBGET integrated database retrieval system