KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1325Help
Entry
SACOL1325         CDS       T00225                                 

Gene name
gpxA1
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00480  Glutathione metabolism
sac00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SACOL1325 (gpxA1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SACOL1325 (gpxA1)
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SACOL1325 (gpxA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AAW38154
UniProt: Q5HGC7
Position
complement(1342869..1343345)
Genome map
AA seq 158 aa AA seqDB search
METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatttatgattttgtagtagaaacaaataaaggtgttacttacaaattagat
gcatataagggtgacgttatgctaattgttaatacagctagcgaatgtggctttacttca
caatttgaaggtttgcaatcattatacgagaaatacaaagatcaagggtttgtaattcta
ggtttcccttgtaatcaatttggtggccaagaacctggttcaggcgaagaagcagctcaa
aactgtaaattaaactatggtgttaccttccctatgcatcaaaaaatagacgtaaaaggg
gaacatcaattacctttatttagatatttgactgcggcacaacacggattctttaatgag
aaaatcaaatggaatttcactaagtttttagtggatcgcgaaggtaacgttgttaaacga
tttgcacctcaaaaaaaacctgttcaaatcgaaagagaaatagaaaaattattataa

DBGET integrated database retrieval system