KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1408Help
Entry
SACOL1408         CDS       T00225                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SACOL1408 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACOL1408 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACOL1408 (trpB)
Enzymes [BR:sac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SACOL1408 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1418592..1419806
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGDDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMVERGLAND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagcagatgaattaggtttctttggtgaatatggaggg
caatatgttccagaaacattaatgccagcaattattgagttgaaaaaagcttataaagag
gcaaaagcagacccagagtttcaaagagaactggaatactatttatcagagtatgtagga
cgcgcgacaccacttacatatgctgcatcatatactgaaagcctaggtggcgctaaaata
tatttgaaacgagaggatctaaatcatacaggcgcccataaaattaataatgcgttaggt
caagcgttgcttgctaaaagaatgggcaagaagaagcttgttgctgaaactggtgcgggt
caacatggtgtagctagtgctacggttgctgcattatttgatatggaacttgttgtcttt
atgggaagtgaagatattaaaagacaacaacttaatgtatttagaatggaattacttggt
gcaaaggttgtggcagttgaagatggtcaagggactttatcggatgcagttaataaagca
ttgcaatattgggtaagtcatgtagatgatacacattatttattaggttctgcattaggt
ccagacccgttcccaacgattgttagagattttcagagtgtgattggtaaagaaataaaa
tcacagatattgaagaaagaaggtcgacttccggatgcaattgtagcatgtatcggtggt
ggctcaaatgcaatcggtacattttatccatttattaaagatgatgttgcattatacggt
gttgaagccgcaggtcaaggcgatgatactgataaacatgcacttgcaattggcaaagga
tcacctggcgtattacatggtactaaaatgtatttaattcaagatgaagatgggcaagtg
caactagcacattctatttcagcaggacttgattatcctggtattggaccagaacattct
tattaccacgacattggtagagtaacttttgaaaatgctagtgatacacaagcaatgaat
gctttaatcaactttacaaaacatgaaggtattatacctgcaattgaaagtgcacatgca
ctgagttatgttgaaagactagcgcctacgatgtcgaaagaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggtagagcgaggt
cttgcaaatgactaa

DBGET integrated database retrieval system