KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1652Help
Entry
SACOL1652         CDS       T00225                                 

Gene name
aroE
Definition
shikimate 5-dehydrogenase (EC:1.1.1.25)
Orthology
K00014  
shikimate dehydrogenase [EC:1.1.1.25]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sac01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sac00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1681391..1682197)
Genome map
AA seq 268 aa AA seqDB search
MKFAVIGNPISHSLSPVMHRANFNSLGLDDTYEALNIPIEDFHLIKEIISKKELEGFNIT
IPHKERIIPYLDYVDEQAINAGAVNTVLIKDGKWIGYNTDGIGYVKGLHSVYPDLENAYI
LILGAGGASKGIAYELAKFVKPKLTVANRTMARFESWNLNINQISLADAEKYLAEFDIVI
NTTPAGMAGNNESIINLKHLSPNTLMSDIVYIPYKTPILEEAERKGNHIYNGLDMFVYQG
AESFKIWTNKDADINSMKTAVLQQLKGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcagttataggaaatcctatttcacattccttgtcgcccgttatgcataga
gcaaattttaattctttaggattagatgatacttatgaagctttaaatattccaattgaa
gattttcatttaattaaagaaattatttcgaaaaaagaattagaaggctttaatatcaca
attcctcataaagaacgtatcataccgtatttagattatgttgatgaacaagcgattaat
gcaggtgcagttaacactgttttgataaaagatggcaagtggatagggtataatacagat
ggtattggttatgttaaaggattgcacagcgtttatccagatttagaaaatgcatacatt
ttaattttgggcgcaggtggtgcaagtaaaggtattgcttatgaattagcaaaatttgta
aagcccaaattaactgttgcgaatagaacgatggctcgttttgaatcttggaatttaaat
ataaaccaaatttcattagcagatgctgaaaagtatttagctgaattcgatatcgttatt
aatacaacaccagcgggtatggctggaaataacgaaagtattattaatttaaagcatctt
tctcccaatactttaatgagtgatattgtttatataccgtataaaacacctattttagag
gaagcagagcgcaagggaaaccatatttataatggcttagatatgtttgtttaccagggt
gcggaaagctttaaaatttggactaataaagatgctgatattaattctatgaaaacagca
gttttacaacaattaaaaggagaataa

DBGET integrated database retrieval system