KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1652Help
Entry
SACOL1652         CDS       T00225                                 

Gene name
aroE
Definition
(RefSeq) shikimate 5-dehydrogenase (EC:1.1.1.25)
  KO
K00014  
shikimate dehydrogenase [EC:1.1.1.25]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SACOL1652 (aroE)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACOL1652 (aroE)
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     SACOL1652 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1681391..1682197)
Genome map
AA seq 268 aa AA seqDB search
MKFAVIGNPISHSLSPVMHRANFNSLGLDDTYEALNIPIEDFHLIKEIISKKELEGFNIT
IPHKERIIPYLDYVDEQAINAGAVNTVLIKDGKWIGYNTDGIGYVKGLHSVYPDLENAYI
LILGAGGASKGIAYELAKFVKPKLTVANRTMARFESWNLNINQISLADAEKYLAEFDIVI
NTTPAGMAGNNESIINLKHLSPNTLMSDIVYIPYKTPILEEAERKGNHIYNGLDMFVYQG
AESFKIWTNKDADINSMKTAVLQQLKGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcagttataggaaatcctatttcacattccttgtcgcccgttatgcataga
gcaaattttaattctttaggattagatgatacttatgaagctttaaatattccaattgaa
gattttcatttaattaaagaaattatttcgaaaaaagaattagaaggctttaatatcaca
attcctcataaagaacgtatcataccgtatttagattatgttgatgaacaagcgattaat
gcaggtgcagttaacactgttttgataaaagatggcaagtggatagggtataatacagat
ggtattggttatgttaaaggattgcacagcgtttatccagatttagaaaatgcatacatt
ttaattttgggcgcaggtggtgcaagtaaaggtattgcttatgaattagcaaaatttgta
aagcccaaattaactgttgcgaatagaacgatggctcgttttgaatcttggaatttaaat
ataaaccaaatttcattagcagatgctgaaaagtatttagctgaattcgatatcgttatt
aatacaacaccagcgggtatggctggaaataacgaaagtattattaatttaaagcatctt
tctcccaatactttaatgagtgatattgtttatataccgtataaaacacctattttagag
gaagcagagcgcaagggaaaccatatttataatggcttagatatgtttgtttaccagggt
gcggaaagctttaaaatttggactaataaagatgctgatattaattctatgaaaacagca
gttttacaacaattaaaaggagaataa

DBGET integrated database retrieval system