KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1783Help
Entry
SACOL1783         CDS       T00225                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00010  Glycolysis / Gluconeogenesis
sac00620  Pyruvate metabolism
sac00640  Propanoate metabolism
sac00680  Methane metabolism
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01120  Microbial metabolism in diverse environments
sac01130  Biosynthesis of antibiotics
sac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACOL1783 (acs)
   00620 Pyruvate metabolism
    SACOL1783 (acs)
   00640 Propanoate metabolism
    SACOL1783 (acs)
  Energy metabolism
   00680 Methane metabolism
    SACOL1783 (acs)
Enzymes [BR:sac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SACOL1783 (acs)
Lipid biosynthesis proteins [BR:sac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SACOL1783 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAW38311
UniProt: A0A0H2WZ22
Position
complement(1826506..1828212)
Genome map
AA seq 568 aa AA seqDB search
MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTRQPKGVLHVQQAMLVHYISGKYVL
DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRIFVKEGLSAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTME
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgaagtttataaaggagcgcaaggtaaacataaccttaaagattatgaagaa
acatataatacttttgattggaaagacgtagaacaagcattttcttggagtgaaactgga
aaaatgaacatggcatatgaatgcatagatcgccatgtagatcaaggattaggggataaa
atagcgttaaattacaaagatgagcacagaaaagaatcgtatacttataaagatatgcaa
cggttatctaataaagcagcgaatgttttgtctgaacatgcagaagttgacaaaggtgac
agagtatttatatttatgtcgcgtacacctgaactatattttgcgttgttaggtgtttta
aaaattggtgcaattgttgggccgttatttgaagcatttatggaaaaggcagttgcggat
agattagagaacagtgaagctaaagtgttaattactaataaggcattgttacctcgagta
cctgtagataaattaccaaacttgaaaaaaattgttgtcgtagatgaggatgtagaagac
aattacatagacttcattagtttgatggaaactgctagcgatgaatttgacattgaatgg
ttaaagtcggatgatggtttgattttacattatacatcaggttctactaggcaacctaaa
ggtgtattgcatgttcaacaagcaatgttagtgcactatatttctggaaaatatgtatta
gatttacaagaagatgatgtttattggtgtacagcagatccaggttgggttacaggaaca
tcttatggtatttttgcaccatggttaaatggcgctacaaattgtatagctggtggtcgc
ttttcgccagaacagtggtatagtatgattgaagattttaaagtgacgatttggtatacg
gcaccaacagctttaagaatgttaatgagtgctggtgacgatattgttgagaaatatgac
ttgtcatcgttacgttcgattctatcagtaggtgagcctttaaatcctgaagttataaaa
tgggcgaaaaaagtatacggtttaacggtgttagatacttggtggatgacagaaacaggt
ggacatatgattgttaactatccaacgatggacgtcaagcttggctcaatgggcaaacca
ttacctggtattcaagctgcaattatcgatgatgcagggaatgaattaccaccaaatcga
atgggcaaccttgctataaaaaaaggctggccatcaatgatgtatcgtatctggaagaat
ccagaaaaatataaatcatattttattggagactggtatgtatctggtgattcggcatat
aaagatgaagatggttacttctggttccaaggacgtgttgatgatgtaattatgacagct
ggtgaacgagttggaccatttgaggttgagtctaaattggttgaacacgaagcagttgcc
gaagcaggaattattggtaaacctgatccggttcgcggtgaaataattaaggcgtttgtt
gcactgagaaaaggatatgaaccaacagacgaattaaaagaagaaattcgtatatttgtt
aaagaaggtttgtcggcacatgcagcaccacgtgaaatcgaatttaaagataaattacct
aaaacacggtcaggtaaaattatgagacgtgtattaaaagcttgggaattaaatttagat
gctggggatttaagtacaatggaataa

DBGET integrated database retrieval system